National Heart, Lung, and Blood Institute

Epithelial Systems Biology Laboratory (ESBL)


Phosphorylation Sites in IMCD Proteins - Response to Vasopressin

Brief methods: Rat IMCD suspensions were incubated with a vasopressin V2 receptor analog, dDAVP (1 nM), or vehicle for 30 minutes (3 independent pairs). Proteins were digested with trypsin/Lys-C. The peptide samples were labeled with 6-plex TMT and combined. Samples were subjected to phosphopeptide enrichment, using Fe-NTA and TiO2 columns, followed by high pH reversed-phase peptide fractionation. Samples were analyzed by LC-MS/MS (Orbitrap Fusion).

Database was created by Venkatesh Deshpande, Anika Kao, Joe Chou, and Mark Knepper in the Epithelial Systems Biology Laboratory (Mark Knepper, Chief) at the National Heart, Lung and Blood Institute as part of its Kidney Systems Biology Project. (July, 2017 Version)

Click to download processed data as a spreadsheet. Abbreviations: *, phosphorylation site; ?, phosphorylation site (ambiguous site assignment); ^, carbamidomethyl; @, oxidation; #, deamidation; Pjoint, the joint probability between P value from paired t-test and probability that |Mean log2(dDAVP/Control)| differs from zero by empirical Bayes method.

To search, use browser's Find command (Ctrl-F)

Gene Symbol UniProt no. Residue(s) Annotation Peptide log2 Pjoint
(dDAVP/Ctrl)
Slc14a2 Q62668 S84 Urea transporter 2 RES*ELPR 2.49 < E-08
Clip1 Q9JK25 S347 CAP-Gly domain-containing linker protein 1 IS*GTTALQEALK 2.41 < E-08
Sptbn2 Q9QWN8 S2254 Spectrin beta chain, non-erythrocytic 2 GS*LGFYK 2.13 < E-08
Itpr1 P29994 S1756 Inositol 1,4,5-trisphosphate receptor type 1 RES*LTSFGN#GPLSPGGPSKPGGGGGGPGSGSTSR 1.86 < E-08
Aqp2 P34080 S256;S261;S264;S269 Aquaporin-2 RQS*VELHS*PQS*LPRGS*K 1.66 < E-08
Htt P51111 S1833 Huntingtin HS*LSC^TK 1.53 < E-08
Plcl1 Q62688 T94;S96 Inactive phospholipase C-like protein 1 KT*VS*FSSMPSEK 1.49 < E-08
Itpr3 Q63269 S934 Inositol 1,4,5-trisphosphate receptor type 3 KQS*VFGASSLPTGVGVPEQLDR 1.49 < E-08
Sec22b Q4KM74 S137 Vesicle-trafficking protein SEC22b NLGS*INTELQDVQR 1.34 < E-08
Fam129b B4F7E8 S633;S645;S648 Niban-like protein 1 QVVSVVQDEES*GLPFEAGSEPPS*PAS*PDNVTELR 1.32 < E-08
Cdk16 Q63686 S110 Cyclin-dependent kinase 16 IS*TEDINK 1.27 < E-08
Kalrn P97924 S1772 Kalirin S*FDLGSPKPGDETTPQGDSADEK 1.27 < E-08
Arfgef1 D4A631 S1076 Brefeldin A-inhibited guanine nucleotide-exchange protein 1 (BIG1) EGS*LTGTK 1.24 < E-08
Slc14a2 Q62668 S918 Urea transporter 2 RAS*MITK 1.21 < E-08
Washc2 Q80X08 S711;S720 WASH complex subunit 2 KES*IPKVPLLFS*DEEDSEVPSGVKPVDLK 1.21 < E-08
Ndrg1 Q6JE36 S362;S364 Protein NDRG1 S*RS*HTSEDAR 1.19 < E-08
Plcl1 Q62688 S96 Inactive phospholipase C-like protein 1 TVS*FSSM@PSEK 1.16 < E-08
Cdk18 O35832 S66 Cyclin-dependent kinase 18 FS*MEDLNK 1.15 < E-08
Slc44a3 Q6AY92 S590 Choline transporter-like protein 3 NS*LPNEEGTELRPIVR 1.14 < E-08
Aqp2 P34080 S256;S264;S269 Aquaporin-2 RQS*VELHSPQS*LPRGS*K 1.1 < E-08
Aqp2 P34080 S256;S261;S264 Aquaporin-2 QS*VELHS*PQS*LPR 1.06 < E-08
Apc P70478 S2793 Adenomatous polyposis coli protein SS*ADSTSARPSQIPTPVGSSTK 1.06 < E-08
Snx1 Q99N27 S188 Sorting nexin-1 FS*DFLGLYEK 1.02 < E-08
Ralgapb P86410 S499 Ral GTPase-activating protein subunit beta KGS*QMSTDTMVSNPVFDASEFPDNYEAGR 1 < E-08
Cast P27321 S171;T173 Calpastatin KS*LT*PTLPMESTLNK 0.99 < E-08
Syt17 Q62807 S110 Synaptotagmin-17 IS*SLDSR 0.98 < E-08
Phactr1 P62024 S67 Phosphatase and actin regulator 1 SKS*DTPYLAEAR 0.97 < E-08
Pxk Q4FZZ1 S448;S452 PX domain-containing protein kinase-like protein AQS*HHGS*EEER 0.96 < E-08
Sh2d4a Q6AYC8 S51 SH2 domain-containing protein 4A KES*LPVK 0.94 < E-08
Luzp1 Q9ESV1 S261 Leucine zipper protein 1 GS*LDYLK 0.91 < E-08
Stmn1 P13668 S63 Stathmin KS*HEAEVLK 0.9 < E-08
Lrrfip1 Q66HF9 S88 Leucine-rich repeat flightless-interacting protein 1 RGS*GDTSISM@DTEASIR 0.89 < E-08
Dcaf8 Q5U2M6 S118 DDB1- and CUL4-associated factor 8 RAS*RDQDS?SDDER 0.89 < E-08
Sytl4 Q8VHQ7 S217 Synaptotagmin-like protein 4 RDS*LDK 0.88 1.00E-07
Suco Q710E6 S1074 SUN domain-containing ossification factor TS*FPLIR 0.86 < E-08
Arhgef1 Q9Z1I6 S301 Rho guanine nucleotide exchange factor 1 GS*LGISSR 0.86 < E-08
Bloc1s5 B2GV52 S25 Biogenesis of lysosome-related organelles complex 1 subunit 5 DS*LGTAGAAHLIIK 0.86 < E-08
Slco4a1 Q99N01 S67 Solute carrier organic anion transporter family member 4A1 RSS*QAAC^EVQYLSSGPQSTLC^GWQSFTPK 0.85 < E-08
Stxbp5 Q9WU70 S760 Syntaxin-binding protein 5 KLS*LPTDLKPDLDVK 0.85 < E-08
Ccdc8 P62521 S99;S102;S104 Coiled-coil domain-containing protein 8 LVVGTYDSS*NGS*DS*ELSDFDTSK 0.85 1.00E-07
Hspb6 P97541 S16 Heat shock protein beta-6 AS*APLPGFSTPGR 0.83 < E-08
Ctnnb1 Q9WU82 T551 Catenin beta-1 RT*SM@GGTQQQFVEGVR 0.83 < E-08
Pi4kb O08561 S511;T517 Phosphatidylinositol 4-kinase beta RLS*EQLAHT*PTAFK 0.82 < E-08
Abcc1 Q8CG09 S289;S290 Multidrug resistance-associated protein 1 DPTKPKGS*S*QLDVNEEVEALIVK 0.82 < E-08
Ociad1 Q5XIG4 S198 OCIA domain-containing protein 1 KS*VTYEELR 0.82 1.00E-07
Igsf5 Q5VJ70 S334 Immunoglobulin superfamily member 5 SS*LPQQELDK 0.81 2.00E-07
Ssr3 Q08013 S105 Translocon-associated protein subunit gamma LS*EADNRK 0.81 8.00E-07
Arhgef7 O55043 S560 Rho guanine nucleotide exchange factor 7 KES*APQVLLPEEEK 0.8 1.00E-07
Rflnb Q6AXS9 S6 Refilin-B LS*LQDVPELVDTK 0.8 1.00E-07
Xk Q5GH61 S403 Membrane transport protein XK KS*TEPVGR 0.78 1.00E-06
Ctnnb1 Q9WU82 S552 Catenin beta-1 RTS*M@GGTQQQFVEGVR 0.77 1.00E-07
Pi4ka O08662 S250;S251 Phosphatidylinositol 4-kinase alpha KTS*S*VSSISQVSPER 0.76 < E-08
Map2 P15146 S1547 Microtubule-associated protein 2 SS*LPRPSSILPPR 0.75 3.00E-07
Arhgef2 Q5FVC2 S885 Rho guanine nucleotide exchange factor 2 S*LPAGDALYLSFNPPQPSR 0.74 2.00E-07
Aqp2 P34080 S256;S264 Aquaporin-2 QS*VELHSPQS*LPR 0.74 1.00E-06
Trim28 O08629 S595;T600 Transcription intermediary factor 1-beta LAS*PS?GST*SSGLEVVAPEVTSAPVSGPGILDDSATIC^R 0.74 8.60E-06
Ajuba Q5U2Z2 S89 LIM domain-containing protein ajuba GS*FEAQR 0.73 < E-08
Arhgef6 Q5XXR3 S680 Rho guanine nucleotide exchange factor 6 KDS*VPQVLLPEEEK 0.73 3.00E-07
Itpr3 Q63269 S1832 Inositol 1,4,5-trisphosphate receptor type 3 VSS*FSMPSSSR 0.72 5.00E-07
Lrrc8a Q4V8I7 S199 Volume-regulated anion channel subunit LRRC8A KSS*TVSEDVEATVPMLQR 0.71 6.00E-07
Itpr1 P29994 S1756;S1766 Inositol 1,4,5-trisphosphate receptor type 1 RES*LTSFGN#GPLS*PGGPSKPGGGGGGPGSGSTSR 0.7 2.10E-06
Nlrc4 F1M649 S379 NLR family CARD domain-containing protein 4 HS*GGTSGDFVR 0.7 3.40E-06
Prrc2a Q6MG48 S1088;T1090 Protein PRRC2A TAS*ET*RSEGSEYEEIPK 0.7 5.20E-06
Rrad P55043 S271 GTP-binding protein RAD RES*LGK 0.7 2.44E-05
Myo9b Q63358 S1649 Unconventional myosin-IXb RKS*ELGAEPGHFGVC^VDSLTSDK 0.69 7.00E-07
Borcs6 Q66H43 S173 BLOC-1-related complex subunit 6 S*LDGLSGAC^GGGGSSSSGEAGAGGGR 0.69 1.10E-06
Aqp2 P34080 S264;S269 Aquaporin-2 QSVELHSPQS*LPRGS*KA 0.68 1.00E-06
Pdlim5 Q62920 S228 PDZ and LIM domain protein 5 GS*QGDIK 0.68 9.30E-06
Slc9a1 P26431 S727;S730;S733 Sodium/hydrogen exchanger 1 ADLPVITIDPAS*PQS*PES*VDLVNEELK 0.68 1.33E-05
Trpm8 Q8R455 T588 Transient receptor potential cation channel subfamily M member 8 GC^T*LAALGASK 0.67 1.40E-06
Pqlc1 Q5M880 S110 PQ-loop repeat-containing protein 1 S*FAATDSK 0.67 1.40E-06
Mprip Q9ERE6 S306 Myosin phosphatase Rho-interacting protein RS*QVIEK 0.67 3.40E-06
Akap13 F1M3G7 S770 A-kinase anchor protein 13 GSS*FSLASSPESESVTK 0.66 4.70E-06
Psen1 P97887 T371;S372 Presenilin-1 AAVQELSGS*ILT*S*EDPEER 0.66 1.03E-05
Ptpn21 Q62728 S670;S675;S676;S679 Tyrosine-protein phosphatase non-receptor type 21 TFS*AGSQS*S*VFS*DKVK 0.65 3.00E-07
Aqp2 P34080 S256 Aquaporin-2 QS*VELHSPQ#SLPR 0.65 3.15E-05
Mtm1 Q6AXQ4 S23 Myotubularin VS*QDGVR 0.65 3.48E-05
Src Q9WUD9 S17 Proto-oncogene tyrosine-protein kinase Src S*LEPAENVHGAGGAFPASQTPSKPASADGHR 0.64 8.00E-07
Pip5k1a D3ZSI8 S55 Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha SVDS*SGETTYK 0.64 5.80E-06
Erbb3 Q62799 S980;T984 Receptor tyrosine-protein kinase erbB-3 RAS*GPGT*PPAAEPSVLTTK 0.63 2.90E-05
Gramd2b Q5FVG8 S113 GRAM domain-containing protein 2B KS*SSSSQYK 0.63 1.34E-04
Igsf5 Q5VJ70 S354 Immunoglobulin superfamily member 5 VS*FDIASPQK 0.62 2.18E-05
Aqp2 P34080 S261;S264;S269 Aquaporin-2 QSVELHS*PQS*LPRGS*KA 0.62 2.40E-05
Slc9a1 P26431 S776;T784 Sodium/hydrogen exchanger 1 SKEPSS*PGTDDVFT*PGPSDSPGSQR 0.62 2.87E-05
Ttl Q9QXJ0 S76 Tubulin--tyrosine ligase KAS*LVK 0.62 1.33E-04
Trip12 F1LP64 S340 E3 ubiquitin-protein ligase TRIP12 RGS*GLGK 0.62 1.97E-04
Rem2 Q9WTY2 S308 GTP-binding protein REM 2 RES*LTK 0.61 8.45E-05
Rab11fip1 Q3B7T9 S386 Rab11 family-interacting protein 1 RLS*DSSTK 0.61 1.53E-04
Prrc2a Q6MG48 S455 Protein PRRC2A KQS*SSEISLAVER 0.6 7.50E-06
Nf1 P97526 S2504 Neurofibromin SMS*LDMGQPSQANTK 0.6 1.59E-05
Maf1 Q5XIH0 S75 Repressor of RNA polymerase III transcription MAF1 homolog S*QGGEDESPLSDK 0.6 5.72E-05
Mpdz O55164 S1065 Multiple PDZ domain protein HS*LIGPDIK 0.59 2.60E-06
Pi4ka O08662 S251 Phosphatidylinositol 4-kinase alpha KT?S?S*VSSISQVSPER 0.59 6.10E-06
Aqp4 P47863 S285;T289 Aquaporin-4 GSYMEVEDNRS*QVET*EDLILKPGVVHVIDIDR 0.59 3.43E-05
Hmga1 Q8K585 S34 Zinc finger Ran-binding domain-containing protein 2 KQPS*VSPGTALVGSQK 0.59 1.92E-04
Usp10 Q3KR59 S608 Ubiquitin carboxyl-terminal hydrolase 10 S*VVYQQ#SSK 0.58 3.47E-05
Klc4 Q5PQM2 S566 Kinesin light chain 4 SS*ELLVR 0.58 3.96E-05
Ccs Q9JK72 S267 Copper chaperone for superoxide dismutase KDS*AQPPAHL 0.57 9.20E-06
Aqp2 P34080 S256;S261 Aquaporin-2 QS*VELHS*PQSLPR 0.57 2.32E-05
Lrrfip2 Q4V7E8 S133 Leucine-rich repeat flightless-interacting protein 2 GS*GDTSSLIDPDTSLSELR 0.57 2.64E-05
Vps50 F1LSG8 S595 Syndetin KS*DYSLNK 0.57 3.65E-05
Pi4kb O08561 S511 Phosphatidylinositol 4-kinase beta LS*EQLAHTPTAFK 0.55 4.35E-05
Itpr1 P29994 S1589 Inositol 1,4,5-trisphosphate receptor type 1 DS*VLAASR 0.55 1.18E-04
Prpf38b Q6AXY7 S511 Pre-mRNA-splicing factor 38B RDHDS*KDQSDR 0.55 6.70E-04
Asah1 Q6P7S1 Y314;T318;T326 Acid ceramidase WY*VVQT*NYDRWKN#T*LFLDDR 0.55 9.98E-04
Mtus1 Q6IMY1 S394 Microtubule-associated tumor suppressor 1 homolog LS*MENEELLWK 0.54 4.14E-05
Myo9b Q63358 S1327 Unconventional myosin-IXb IS*FSTSDVSK 0.54 4.67E-05
Pom121 P52591 S518 Nuclear envelope pore membrane protein POM 121 AS*LQWFNK 0.54 5.70E-05
Nsfl1c O35987 S176 NSFL1 cofactor p47 HS*GQDVHVVLK 0.54 8.90E-05
Raf1 P11345 S259 RAF proto-oncogene serine/threonine-protein kinase STS*TPNVHMVSTTLPVDSR 0.54 9.15E-05
Dok1 Q4QQV2 S269 Docking protein 1 TDS*HDGETEGK 0.54 9.72E-04
Tcea1 Q4KLL0 S57 Transcription elongation factor A protein 1 KQS*TDEEVTSLAK 0.53 6.40E-06
Nxpe4 Q5XI89 S287 NXPE family member 4 S*N#VISVSK 0.53 1.87E-05
Dstn Q7M0E3 S24 Destrin C^S*TPEEIK 0.53 6.32E-05
Cd2ap F1LRS8 S232;S233 CD2-associated protein TRTS*S*SETEEK 0.53 6.56E-04
Rai14 Q5U312 S281;S289;S290 Ankycorbin APPPPIS*PTQLSDVS*S*PR 0.53 7.03E-04
Pi4ka O08662 S250;S251;S254 Phosphatidylinositol 4-kinase alpha KTS*S*VSS*ISQVSPER 0.52 2.63E-05
Eif3a Q1JU68 T574 Eukaryotic translation initiation factor 3 subunit A RQT*IEER 0.52 2.82E-05
Slc38a1 Q9JM15 S52;S56 Sodium-coupled neutral amino acid transporter 1 S*LTNS*HLEK 0.52 1.49E-04
Rplp0 P19945 S304 60S acidic ribosomal protein P0 EES*EESDEDMGFGLFD 0.52 7.04E-04
Cux1 P53565 T1375 Homeobox protein cut-like 1 AQPLSSGT*PGQDDGEDAGR 0.52 0.001
Veph1 Q5PQS3 S430 Ventricular zone-expressed PH domain-containing protein homolog 1 YS*LDHVSK 0.51 3.41E-05
Mark2 O08679 T374;S390 Serine/threonine-protein kinase MARK2 SSELEGDTIT*LKPRPSADLTNSSAPS*PSHK 0.51 1.16E-04
Myo9b Q63358 S1177 Unconventional myosin-IXb AS*LETGESFPEDTK 0.51 1.92E-04
Washc2 Q80X08 S795 WASH complex subunit 2 TVLS*LFDEDEDKVEDDSNTC^APQGGLEK 0.5 4.53E-04
Dcaf8 Q5U2M6 S118;S123;S124 DDB1- and CUL4-associated factor 8 RAS*RDQDS*S*DDER 0.5 6.73E-04
Faah P97612 T236 Fatty-acid amide hydrolase 1 SPGGSSGGEGALIGSGGSPLGLGT*DIGGSIR 0.5 0.002
Slc14a2 Q62668 S486 Urea transporter 2 S*VFHIEWSSIR 0.49 9.02E-05
Lrrfip2 Q4V7E8 S125;S129 Leucine-rich repeat flightless-interacting protein 2 NSASATTPLS*GNSS*R 0.49 1.97E-04
Macf1 D3ZHV2 S5009 Microtubule-actin cross-linking factor 1 S*LNQPTPPPMPILSQSEAK 0.49 2.49E-04
Wdr44 Q9R037 T263 WD repeat-containing protein 44 SDLEFEALKT*PDLDVPK 0.49 5.79E-04
Ndrg1 Q6JE36 T346;S347 Protein NDRG1 SHT*S*EGPR 0.49 0.002
Atg9a Q5FWU3 S735 Autophagy-related protein 9A RES*DESGESAPEEGGEGAR 0.48 2.77E-04
Ocln Q6P6T5 T377 Occludin YSSNDNLET*PSK 0.48 0.001
Cobl D3ZUI5 S648 Protein cordon-bleu RNS*MEK 0.48 0.003
Pkn1 Q63433 S377 Serine/threonine-protein kinase N1 SGS*LSGR 0.48 0.003
Lmna P48679 S404;S406 Prelamin-A/C ASS*HS*SQSQGGGSVTK 0.48 0.003
Arpp19 Q712U5 S104 cAMP-regulated phosphoprotein 19 KPS*LVASK 0.47 1.10E-05
Plcl1 Q62688 S570 Inactive phospholipase C-like protein 1 RVS*GDYN#GEQK 0.47 3.94E-05
Prkd1 Q9WTQ1 S255 Serine/threonine-protein kinase D1 SNS*QSYVGRPIQLDK 0.47 6.46E-05
Yap1 Q2EJA0 S363 Transcriptional coactivator YAP1 DES*TDSGLSMSSYSIPR 0.47 6.61E-04
Prpf4b Q5RKH1 S62 Serine/threonine-protein kinase PRP4 homolog HSS*EEDRDK 0.47 0.002
Cldn3 Q63400 S202 Claudin-3 S*TGPGTGTGTAYDR 0.47 0.003
Mavs Q66HG9 S172;S186 Mitochondrial antiviral-signaling protein MS*GDSLISSPNPPALS*PQPSR 0.46 5.85E-04
Tsc22d4 Q3B8N7 S165 TSC22 domain family protein 4 S*FTGGLGQLAGPGK 0.46 8.29E-04
Gtf2f1 Q6AY96 S8 General transcription factor IIF subunit 1 M@AALGSSS*QNVT?EYVVR 0.45 2.95E-04
Poc5 Q4V891 S80 Centrosomal protein POC5 ETALEVGKGS*DLNISSLSK 0.45 0.002
Pitpnm1 Q5U2N3 S633 Membrane-associated phosphatidylinositol transfer protein 1 TS*SDMANPDPDGSQNSLQVAPTVTSGEPR 0.45 0.003
Sh2b1 Q62985 S320 SH2B adapter protein 1 LS*IPC^STITDVR 0.44 2.25E-04
Nf1 P97526 S2524 Neurofibromin S*FDHLISDTK 0.44 2.89E-04
Macf1 D3ZHV2 S5372;S5387 Microtubule-actin cross-linking factor 1 RGS*DASDFDLLETQSAC^S*DTSESSAAGGQGSSR 0.44 3.97E-04
Agrn P25304 S571 Agrin EAAC^QQQVQ#IEEAHAGPC^EPAEC^GSGGSGS*GEDDEC^EQELC^R 0.44 5.36E-04
Plcb3 Q99JE6 S1105 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 N#NS*ISEAK 0.44 0.001
Slu7 Q80ZG5 S510;S511;S512;S514 Pre-mRNA-splicing factor SLU7 HRKS*S*S*DS*DDDEER 0.44 0.002
Ocln Q6P6T5 S336;S340 Occludin RS*YPDS*LYK 0.44 0.003
Cd2ap F1LRS8 T231 CD2-associated protein TRT*SSSETEEK 0.44 0.005
Ralgapa1 O55007 S817 Ral GTPase-activating protein subunit alpha-1 VNKEDTS*PK 0.44 0.005
Kalrn P97924 S375 Kalirin Q$IS*TQLDQ#EWK 0.43 1.57E-04
Cnksr3 Q5SGD7 S381;S383 Connector enhancer of kinase suppressor of ras 3 KGS*ES*PNSFLDQESQR 0.43 2.11E-04
Carhsp1 Q9WU49 S30;S32 Calcium-regulated heat stable protein 1 DRS*PS*PLRGNVVPSPLPTR 0.43 2.32E-04
Mark2 O08679 S380;S390 Serine/threonine-protein kinase MARK2 SSELEGDTITLKPRPS*ADLTNSSAPS*PSHK 0.43 2.64E-04
Ston2 D4AB66 S743 Stonin-2 ES*VLGEK 0.43 3.24E-04
Lnpep P97629 S91 Leucyl-cystinyl aminopeptidase NS*ATGYR 0.43 0.001
Prkab1 P80386 T28 5'-AMP-activated protein kinase subunit beta-1 DSSGGT*KDGDRPK 0.43 0.005
Rsrc2 Q5PQR4 S35 Arginine/serine-rich coiled-coil protein 2 SEEHNDKEHS*SDKGR 0.43 0.007
Lrrfip2 Q4V7E8 S129 Leucine-rich repeat flightless-interacting protein 2 N#SASATTPLSGNSS*R 0.42 2.18E-04
Ocln Q6P6T5 S302;T305 Occludin NVS*AGT*QDMPPPPSDYAER 0.42 0.002
Cdk18 O35832 S75 Cyclin-dependent kinase 18 LS*LPMDIR 0.42 0.003
Ocln Q6P6T5 S409 Occludin TDPDHYETDYTTGGES*C^DELEEDWLR 0.42 0.004
Casp6 O35397 S62 Caspase-6 FS*ELGFEVK 0.41 7.89E-05
Optn Q8R5M4 S346 Optineurin KNS*ATPSELNEK 0.41 0.004
Apc P70478 S252 Adenomatous polyposis coli protein HETAS*HEAER 0.41 0.01
Slc9a1 P26431 T722;S733 Sodium/hydrogen exchanger 1 ADLPVIT*IDPAS?PQSPES*VDLVNEELK 0.4 1.05E-04
Mark2 O08679 T374 Serine/threonine-protein kinase MARK2 SSELEGDTIT*LKPRPSADLTNSSAPSPSHK 0.4 4.26E-04
Klc3 Q68G30 S173 Kinesin light chain 3 RDS*LASLFPSEEEEK 0.4 5.95E-04
Isyna1 Q6AYK3 S532 Inositol-3-phosphate synthase 1 KES*TPATN#GC^TGDAN#GHTQ#APTPELSTA 0.4 7.04E-04
Hmgn3 Q66H40 S6 High mobility group nucleosome-binding domain-containing protein 3 KS*PEN#AEGK 0.4 0.006
Thrap3 Q5M7V8 S737;S740;S746 Thyroid hormone receptor-associated protein 3 SRES*VDS*RDS?SHS*R 0.4 0.007
Ppig O55035 S628 Peptidyl-prolyl cis-trans isomerase G S*SEREESQSR 0.4 0.012
Pgd P85968 S257 6-phosphogluconate dehydrogenase, decarboxylating IRDS*AGQK 0.4 0.012
Kazn Q5FWS6 S351 Kazrin THS*LC^N#GDSPGPVQK 0.39 4.80E-04
Erbb3 Q62799 S980 Receptor tyrosine-protein kinase erbB-3 RAS*GPGTPPAAEPSVLTTK 0.39 0.001
Pitpnm1 Q5U2N3 S663 Membrane-associated phosphatidylinositol transfer protein 1 RAS*TASC^PPASSEAPDGPTNAAR 0.39 0.007
Mre11 Q9JIM0 S674 Double-strand break repair protein MRE11 MS*QSQTAK 0.39 0.012
Haus8 Q5BK57 S372 HAUS augmin-like complex subunit 8 DHS*PTQDR 0.39 0.013
Rsrc1 Q5PPJ2 S6;T8 Serine/Arginine-related protein 53 RSS*DT*EEESR 0.39 0.014
Clec2d11 Q0H8B9 S7;S16 C-type lectin domain family 2 member D11 KAS*QPMLNTTGS*LQEGEMGK 0.38 9.79E-04
Myo5b P70569 S1288 Unconventional myosin-Vb TS*WPNSEK 0.38 0.001
Poll Q5RKI3 S357 DNA polymerase lambda S*LEDIR 0.38 0.002
Map3k7 P0C8E4 S439 Mitogen-activated protein kinase kinase kinase 7 S*IQDLTVTGTEPGQVSSR 0.38 0.002
Slc16a10 Q91Y77 S37;S43 Monocarboxylate transporter 10 ETNEAQ#PPGPAPSDDAPLPVPGPS*DVSDGS*VEKVEVELTR 0.38 0.002
Aqp4 P47863 S276;T289 Aquaporin-4 GS*YMEVEDN#RSQVET*EDLILKPGVVHVIDIDRGDEK 0.38 0.003
Tle3 Q9JIT3 S217 Transducin-like enhancer protein 3 HRGS*ADYSMEAK 0.38 0.003
Slc9a1 P26431 S776;T784;S790 Sodium/hydrogen exchanger 1 SKEPSS*PGTDDVFT*PGPSDS*PGSQR 0.38 0.004
Hsph1 Q66HA8 T486 Heat shock protein 105 kDa VNT*HGIFTISTASMVEK 0.38 0.005
Slc9a1 P26431 T722 Sodium/hydrogen exchanger 1 ADLPVIT*IDPAS?PQS?PESVDLVNEELK 0.38 0.007
Sh3kbp1 Q925Q9 S225 SH3 domain-containing kinase-binding protein 1 ETTGS*ESDGGDSSSTK 0.38 0.012
Canx P35565 S553;T561 Calnexin Q#KS*DAEEDGGT*GSQDEEDSKPK 0.38 0.015
Cfdp1 Q75UQ2 S66;S80;S83 Craniofacial development protein 1 KQS*GLLLDEEEDGEEDS*GGS*SREEDEEEQEGGLGSETSR 0.37 9.12E-04
Pfkl P30835 S775 ATP-dependent 6-phosphofructokinase, liver type TLS*IDKGF 0.37 0.002
Mtmr3 Q5PQT2 S4 Myotubularin-related protein 3 HS*LEC^IQANQIFPR 0.37 0.002
Syt17 Q62807 S110;S111 Synaptotagmin-17 RIS*S*LDSR 0.37 0.002
Aqp4 P47863 S315 Aquaporin-4 GKDS*SGEVLSSV 0.37 0.002
Prkd1 Q9WTQ1 S835 Serine/threonine-protein kinase D1 RYS*VDK 0.37 0.003
Map2 P15146 T1608;T1611 Microtubule-associated protein 2 SGTSTPTTPGSTAIT*PGT*PPSYSSR 0.37 0.008
Ocln Q6P6T5 S313 Occludin NVSAGTQ#DMPPPPS*DYAER 0.37 0.01
Zhx3 Q80Z36 S919;S940;S941 Zinc fingers and homeoboxes protein 3 VLGDAC^AALS*EN#SEAWEPSAPEAGSEPFDTS*S*PQSGR 0.37 0.015
Palmd Q4KM62 S163 Palmdelphin NEES*DDEQNRK 0.37 0.016
Plec P30427 S2581 Plectin QQS*DQDAER 0.37 0.019
Lrrc8d Q5U308 S262 Volume-regulated anion channel subunit LRRC8D FS*AEKPVIEVPSMTILDK 0.36 6.18E-04
Cd44 P26051 S458 CD44 antigen KPS*ELN#GEASK 0.36 8.85E-04
Slc9a1 P26431 S730;S733 Sodium/hydrogen exchanger 1 ADLPVITIDPAS?PQS*PES*VDLVNEELK 0.36 9.56E-04
Bin1 O08839 S304 Myc box-dependent-interacting protein 1 SPSPPPDGS*PAATPEIR 0.36 9.60E-04
Lrrfip2 Q4V7E8 T121;S129 Leucine-rich repeat flightless-interacting protein 2 NSASAT*TPLSGNSS*R 0.36 0.003
Gsn Q68FP1 T557 Gelsolin DGGQ#TT*PASTR 0.36 0.003
Wdr70 Q5EB92 S644 WD repeat-containing protein 70 TMFAQVESDDEES*KNEPEWK 0.36 0.003
Mcrip1 B0BN72 S17;S21 Mapk-regulated corepressor-interacting protein 1 RNS*SPRS*PTNSSEIFTPAHEENVR 0.36 0.003
Src Q9WUD9 S17;S42 Proto-oncogene tyrosine-protein kinase Src S*LEPAENVHGAGGAFPASQ#TPSKPAS*ADGHR 0.36 0.004
Ocln Q6P6T5 T405;S409 Occludin TDPDHYETDYTT*GGES*C^DELEEDWLR 0.36 0.004
Slk O08815 S340;S344 STE20-like serine/threonine-protein kinase RAS*SDLS*IASSEEDK 0.36 0.006
Rnf146 Q5XIK5 T286;S288;S291;S292 E3 ubiquitin-protein ligase RNF146 VPDTSTEET*ES*DAS*S*DIEDAPVVVAQ#HSLTQQR 0.36 0.008
Ppp2r5b Q80W83 T10;S20 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform LPPAST*PTS?PS?SPGLS*PVPPPDKVDGFSR 0.36 0.012
Sart1 Q5XIW8 S597 U4/U6.U5 tri-snRNP-associated protein 1 S*AN#GGSESDGEENIGWS?T?VNLDEEK 0.36 0.015
Mindy1 Q5BJQ2 S396 Ubiquitin carboxyl-terminal hydrolase MINDY-1 SHGAEGGSGS*PEK 0.36 0.018
Pi4ka O08662 S250 Phosphatidylinositol 4-kinase alpha TS*SVSSISQVSPER 0.35 7.55E-04
Nucks1 Q9EPJ0 T202 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 EKT*PSPKEEDEEAESPPEK 0.35 0.001
Phka1 Q64649 S980;S983 Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform SVRPTDS*NVS*PAISIHEIGAVGATK 0.35 0.002
Lrrfip2 Q4V7E8 S133;T136 Leucine-rich repeat flightless-interacting protein 2 RGS*GDT*S?SLIDPDTSLSELR 0.35 0.004
Sh3bp4 Q9JJS5 S117;S120;S131 SH3 domain-binding protein 4 NS*TLS*DSGMIDNLPDS*PDEVAK 0.35 0.008
Mink1 F1LP90 S703 Misshapen-like kinase 1 SNS*AWQIYLQR 0.35 0.009
Notch2 Q9QW30 T1318 Neurogenic locus notch homolog protein 2 SAFTGRHC^ETFLDVC^PQKPC^LNGGT*C^AVASNVPDGFIC^R 0.35 0.009
Arglu1 Q5BJT0 S56;S58;S60 Arginine and glutamate-rich protein 1 S*RS*RS*TNAAASR 0.35 0.011
Phrf1 Q63625 S734 PHD and RING finger domain-containing protein 1 ADS*EPSSR 0.35 0.02
Ppig O55035 S714 Peptidyl-prolyl cis-trans isomerase G TRS*PVEK 0.35 0.025
Dlgap4 P97839 S665 Disks large-associated protein 4 LS*SIGIQVDC^IQPVPK 0.34 9.37E-05
Luzp1 Q9ESV1 S612 Leucine zipper protein 1 S*QENILQGFSVPNK 0.34 9.50E-04
Afdn O35889 S1517 Afadin EELSSGDSLS*PDPWK 0.34 0.001
Arhgdia Q5XI73 S34 Rho GDP-dissociation inhibitor 1 S*IQEIQELDKDDESLR 0.34 0.002
Slc33a1 Q6AYY8 S16 Acetyl-coenzyme A transporter 1 S*GMFGHALDMK 0.34 0.005
Pxn Q66H76 S327;S335 Paxillin TGSSSPPGGLSKPGS*QLDSMLGS*LQSDLNK 0.34 0.005
Pitpnm1 Q5U2N3 S663;S666 Membrane-associated phosphatidylinositol transfer protein 1 RAS*TAS*C^PPASSEAPDGPTNAAR 0.34 0.005
Cfdp1 Q75UQ2 S80;S83;S84 Craniofacial development protein 1 QSGLLLDEEEDGEEDS*GGS*S*R 0.34 0.009
Cldn3 Q63400 S202;T207 Claudin-3 S*TGPGT*GTGTAYDR 0.34 0.01
Fam129b B4F7E8 S645;S648 Niban-like protein 1 QVVSVVQ#DEESGLPFEAGS?EPPS*PAS*PDNVTELR 0.34 0.011
Eif2ak4 D4A7V9 S752;S754;S756 eIF-2-alpha kinase GCN2 DGVFSQSFLPAS*DS*DS*DIIFDNEDENSK 0.34 0.011
Tonsl D4A615 S992 Tonsoku-like protein DGALLAPQ#DPIPDVLQ#S*NDEVMAEVTSWDLPPLK 0.34 0.013
Cldn15 D3ZQJ0 S214;S217 Claudin-15 ATSDES*DVS*FGK 0.34 0.021
Hdlbp Q9Z1A6 S756 Vigilin VRDS*TGAR 0.34 0.029
Zfp36l1 P17431 S54 mRNA decay activator protein ZFP36L1 HS*VTLPSSK 0.33 1.01E-04
Mark2 O08679 S409 Serine/threonine-protein kinase MARK2 RSS*DQAVPAIPTSNSYSK 0.33 3.44E-04
Limd1 B5DEH0 S303 LIM domain-containing protein 1 DS*SLGYEAPGR 0.33 7.62E-04
Lrrfip2 Q4V7E8 S128;S129 Leucine-rich repeat flightless-interacting protein 2 NSASATTPLSGNS*S*R 0.33 8.61E-04
Slc20a2 Q63488 S459;T462 Sodium-dependent phosphate transporter 2 LAS*ELT*DPDQPHEDPAEDEKEEK 0.33 9.89E-04
Eif3b Q4G061 S75;S79;S84 Eukaryotic translation initiation factor 3 subunit B AKPAAQ#SEEETAAS*PAAS*PTPQ#S*AQEPSAPGK 0.33 0.002
Pkn2 O08874 S623 Serine/threonine-protein kinase N2 SKS*EYELNIPDSSR 0.33 0.004
Pde7a O08593 S28 High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (Fragment) GS*HPYIDFR 0.33 0.004
Nup153 P49791 T97 Nuclear pore complex protein Nup153 EIYVDENTNT*DDGR 0.33 0.005
Arfip1 Q9JHU5 S36 Arfaptin-1 DLKHS*LPSGLGLSETQITSHGFDSTK 0.33 0.007
Aqp4 P47863 S276;S285 Aquaporin-4 GS*YM@EVEDNRS*Q#VETEDLILKPGVVHVIDIDR 0.33 0.008
Map1b P15205 S560 Microtubule-associated protein 1B ES*KEEAPEATK 0.33 0.009
Mark2 O08679 S380 Serine/threonine-protein kinase MARK2 SSELEGDTITLKPRPS*ADLTNSSAPSPSHK 0.33 0.016
Nucks1 Q9EPJ0 T202;S204;S214 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 EKT*PS*PKEEDEEAES*PPEK 0.33 0.024
Arglu1 Q5BJT0 S58;S60 Arginine and glutamate-rich protein 1 S*RS*TNAAASR 0.33 0.026
Cd2ap F1LRS8 S232 CD2-associated protein TS*SSETEEK 0.33 0.028
Myo9b Q63358 S1044 Unconventional myosin-IXb S*FSQMMLEK 0.32 4.83E-04
Cfdp1 Q75UQ2 S66;S80;S83;S84 Craniofacial development protein 1 KQS*GLLLDEEEDGEEDS*GGS*S*REEDEEEQ#EGGLGSETSR 0.32 8.87E-04
Eps8 F1M3L7 S685 Epidermal growth factor receptor kinase substrate 8 KS*QMEEVQDELFQR 0.32 0.001
Cracr2b B0BNK9 S223 EF-hand calcium-binding domain-containing protein 4A RQS*QNPPREEER 0.32 0.001
Hmga1 Q8K585 S99;S102 Zinc finger Ran-binding domain-containing protein 2 KLEKEEEEGIS*Q#ES*SEEEQ 0.32 0.004
Epb41l1 Q9WTP0 T33 Band 4.1-like protein 1 AQEETPQQPEAAAAVTT?PVT*PAGHSHPETNSNEK 0.32 0.004
Zranb2 O35986 S153;S165 Zinc finger Ran-binding domain-containing protein 2 EVEDKES*EGEEEDEDEDLS*KYK 0.32 0.004
Ets1 P41156 S267;S270;S273 Protein C-ets-1 LTQS*WSS*QSS*FNSLQR 0.32 0.005
Cdk12 Q3MJK5 S332;S333 Cyclin-dependent kinase 12 SS*S*PFLSK 0.32 0.006
Prune1 Q6AYG3 S430 Exopolyphosphatase PRUNE1 LS*AEAVFEK 0.32 0.006
Gsk3a P18265 S21 Glycogen synthase kinase-3 alpha TSS*FAEPGGGGGGGGGGPGGSASGPGGTGGGK 0.32 0.007
Pkn2 O08874 S638 Serine/threonine-protein kinase N2 SC^WS*VGELEDKR 0.32 0.007
Pitpnm1 Q5U2N3 S316;S318 Membrane-associated phosphatidylinositol transfer protein 1 SS*YS*SQHGGGVSPQSLSEWR 0.32 0.007
Klc1 P37285 S524 Kinesin light chain 1 SRES*LNVDVVK 0.32 0.009
Slc16a1 P53987 S210;S213 Monocarboxylate transporter 1 LKS*KES*LQEAGK 0.32 0.011
Prpf4b Q5RKH1 S21;S24;S33 Serine/threonine-protein kinase PRP4 homolog EQPEMDDADNS*EKS*VN#EEN#GEVS*EDQSQNK 0.32 0.013
Plekhm1 Q5PQS0 T473;S480 Pleckstrin homology domain-containing family M member 1 NTSDLC^ISPLQGTPELRT*ALHGPFS*QGPR 0.32 0.017
Sh3bp4 Q9JJS5 S120;S131 SH3 domain-binding protein 4 NST?LS*DSGMIDNLPDS*PDEVAK 0.32 0.019
Tra2b P62997 S81;S83 Transformer-2 protein homolog beta S*RS*RS?YSR 0.32 0.02
Agfg1 Q4KLH5 S187 Arf-GAP domain and FG repeat-containing protein 1 S*QGQ#Q#Q#EK 0.32 0.03
Aqp1 P29975 S262 Aquaporin-1 VWTSGQVEEYDLDADDIN#S*R 0.32 0.03
Stat3 P52631 Y705 Signal transducer and activator of transcription 3 YC^RPESQ#EHPEADPGSAAPY*LK 0.32 0.035
Afap1l1 D4AB98 S342 Actin filament-associated protein 1-like 1 RLS*QEK 0.32 0.037
Sh3kbp1 Q925Q9 S227 SH3 domain-containing kinase-binding protein 1 ETTGSES*DGGDSSSTK 0.32 0.038
Ipcef1 Q80VL0 S125 Interactor protein for cytohesin exchange factors 1 ESTTKDEEC^YS*ESEQ#EDPETAVEAPPPPSASATSSPVAAR 0.31 5.29E-04
Ptpn2 P35233 S320 Tyrosine-protein phosphatase non-receptor type 2 IGS*EDEKLTGLSSK 0.31 0.004
Zdhhc5 Q2THW7 S296;S299 Palmitoyltransferase ZDHHC5 S*KGS*LEITESQSADAEPPPPPKPDLSR 0.31 0.004
Chd6 D3ZA12 S1852 Chromodomain-helicase-DNA-binding protein 6 LILNQS*DEEEEEN#EK 0.31 0.005
Clip1 Q9JK25 S199;S203 CAP-Gly domain-containing linker protein 1 TASESISNLS*EAGS*VK 0.31 0.008
Ptpn21 Q62728 S700;S710;S711 Tyrosine-protein phosphatase non-receptor type 21 KS*LSDATMLIHS*S*EEDEDLEDDSSR 0.31 0.009
Cdc42bpb Q7TT49 S1659 Serine/threonine-protein kinase MRCK beta S*MSDPDQDFDKEPDSDSTK 0.31 0.009
Cblb Q8K4S7 S521;S525 E3 ubiquitin-protein ligase CBL-B S*PC^GS*PTGSPK 0.31 0.01
Hmga1 Q8K585 S44 Zinc finger Ran-binding domain-containing protein 2 KQPSVSPGTALVGS*QKEPSEVPTPK 0.31 0.011
Eif3a Q1JU68 T982 Eukaryotic translation initiation factor 3 subunit A RGT*DDDRPSWR 0.31 0.012
Ybx1 P62961 S100 Nuclease-sensitive element-binding protein 1 S*VGDGETVEFDVVEGEK 0.31 0.017
Camkk2 O88831 S128;S136 Calcium/calmodulin-dependent protein kinase kinase 2 C^IC^PSLSYS*PASS?PQSS*PR 0.31 0.024
Shroom2 Q7TP36 S755 Protein Shroom2 ATS*C^GEILSEDR 0.31 0.025
Paf1 Q4V886 S394;S402;S409 RNA polymerase II-associated factor 1 homolog EAGGS*DEEHEKGS*S?SEKEGS*EDER 0.31 0.025
Acaca P11497 S23;S25;S29 Acetyl-CoA carboxylase 1 FIIGS*VS*EDNS*EDEISNLVK 0.3 0.004
Numb Q2LC84 S237;S239 Protein numb homolog TVGPSVAPGN#SAPS*PS*SPT?SPTLDPTASLEMNNPHAIPR 0.3 0.006
Fxr1 Q5XI81 S493 Fragile X mental retardation syndrome-related protein 1 SS*ISSVLK 0.3 0.006
Stxbp5 Q9WU70 S693 Syntaxin-binding protein 5 QPS*GAGLC^DITEGTVVPEDR 0.3 0.01
Plcg1 P10686 S1248 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 EGS*FEAR 0.3 0.01
Prrc2a Q6MG48 S1717 Protein PRRC2A RPPAS*HEGER 0.3 0.016
Ocln Q6P6T5 S336 Occludin S*YPDSLYK 0.3 0.018
Add3 Q62847 S600 Gamma-adducin QQQGLDDAEQESLSDDAASVSQ#IQSQTQS*PQSVPER 0.3 0.019
Ybx1 P62961 S163;S165 Nuclease-sensitive element-binding protein 1 NYQQNYQNS*ES*GEKNEGSESAPEGQAQQR 0.3 0.027
Ptbp3 Q9Z118 S425 Polypyrimidine tract-binding protein 3 DFSNS*PLHR 0.3 0.032
Scaf1 Q63624 S1141;S1142 Splicing factor, arginine/serine-rich 19 REGS*S*S?SEGRGDTDK 0.3 0.049
Fam129b B4F7E8 S697 Niban-like protein 1 GLLAQDLQAES?S?PPASPLLNGAPVQESPQ#PM@TVLEASPPAS*PLR 0.3 0.051
Ptk2 O35346 Y576 Focal adhesion kinase 1 YM@EDST?Y*YK 0.3 0.055
Lrrc8d Q5U308 S250;T251 Volume-regulated anion channel subunit LRRC8D HVSTS?SDEGSPSAS*T*PMINK 0.29 1.63E-04
Kif1c O35787 S671 Kinesin-like protein KIF1C LYADS*DS?GEDSDK 0.29 0.001
Stx7 O70257 S126;S129 Syntaxin-7 ASS*RVS*GGFPEDSSK 0.29 0.001
Specc1l Q2KN99 T52 Cytospin-A T*KSNDDLLAGMAGGVNVTN#GVK 0.29 0.002
Dcaf11 Q5M9G8 S147 DDB1- and CUL4-associated factor 11 GS*FSLGEQSR 0.29 0.003
Tab2 Q5U303 S524 TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 KLS*MGSDDAAYTQALLVHQK 0.29 0.003
Washc2 Q80X08 S606;S610;S611 WASH complex subunit 2 KAS*ALFS*S*DEEDQWSVADSQTK 0.29 0.004
Numb Q2LC84 S237;S243;T245 Protein numb homolog TVGPSVAPGNSAPS*PSSPTS*PT*LDPTASLEMN#NPHAIPR 0.29 0.007
Zc3hav1 Q8K3Y6 S667;T668 Zinc finger CCCH-type antiviral protein 1 RLS*T*PSYEEKPLSAVFATK 0.29 0.008
Abcc1 Q8CG09 S916;S919;S920 Multidrug resistance-associated protein 1 HLS*NSS*S*HSVVTNQQHSST?AELQK 0.29 0.008
Aqp4 P47863 S276;Y277 Aquaporin-4 GS*Y*M@EVEDNRSQ#VETEDLILKPGVVHVIDIDR 0.29 0.008
Camkk2 O88831 S510 Calcium/calmodulin-dependent protein kinase kinase 2 SLS*APGNLLTK 0.29 0.009
Arhgef11 Q9ES67 S1462;S1463;T1467 Rho guanine nucleotide exchange factor 11 SLGGES*S*GGTT*PVGSFHTEAAR 0.29 0.009
Afdn O35889 S1506 Afadin DLQYITIS*KEELSSGDSLSPDPWK 0.29 0.01
Magi2 O88382 S727 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 SS*FPDSTEAFDPR 0.29 0.011
Slc15a4 O09014 S279 Solute carrier family 15 member 4 S*GEGLGVFQQSSK 0.29 0.012
Map2 P15146 S628 Microtubule-associated protein 2 ASQPS*PPAHEAGYSTLAQ#SYTSDHPSELPEEPSS?PQER 0.29 0.013
Slc9a1 P26431 T784;S790 Sodium/hydrogen exchanger 1 SKEPSS?PGTDDVFT*PGPSDS*PGSQR 0.29 0.015
Mapt P19332 S573 Microtubule-associated protein tau IGS*TENLK 0.29 0.015
Mapk3 P21708 T203;Y205 Mitogen-activated protein kinase 3 IADPEHDHTGFLT*EY*VATR 0.29 0.017
Tomm22 Q75Q41 S15 Mitochondrial import receptor subunit TOM22 homolog A$AAVAAAGAGEPLS*PEELVPK 0.29 0.019
Myo1e Q63356 S1008 Unconventional myosin-Ie QQSTGSDRLS*QTPESLDFLK 0.29 0.019
Gys1 A2RRU1 S653;S657 Glycogen [starch] synthase, muscle HSS*PHQS*EDEEEPR 0.29 0.02
Rps20 P60868 T9 40S ribosomal protein S20 DTGKT*PVEPEVAIHR 0.29 0.02
Fam122a Q6AYT4 S275 Protein FAM122A VSTTT?DS?PVSPAQAAS*PFIPVDELSSK 0.29 0.024
Ogfrl1 Q4KLH3 T25;S27 Opioid growth factor receptor-like protein 1 EPTTVEDC^DSTWQT*DS*EPEPEQPGPAGGGEGQEQDER 0.29 0.024
Eef2k P70531 S77 Eukaryotic elongation factor 2 kinase TEC^GS?TGS?PASS*FHFK 0.29 0.027
Ocln Q6P6T5 S371 Occludin YSS*N#DNLETPSK 0.29 0.027
Pacs1 O88588 S779 Phosphofurin acidic cluster sorting protein 1 VGLVEDSPSTAGDGDDSPVVSLTVPSTS*PPSSSGLSR 0.29 0.027
Bag6 Q6MG49 T200 Large proline-rich protein BAG6 GGTQAQASQPPPQ#T*PTVASETVALNSQTSEPVESEAPPR 0.29 0.028
Ppp1r9a O35867 S160 Neurabin-1 SGHESGQN#NRHS*PK 0.29 0.029
Lysmd1 Q5HZA4 S99 LysM and putative peptidoglycan-binding domain-containing protein 1 DLFN#GLDS*EEEEN#DGEEEVRPSKDEIGSSSGK 0.29 0.034
Aqp1 P29975 Y253 Aquaporin-1 VWTSGQVEEY*DLDADDINSR 0.29 0.043
Tra2b P62997 S22;S26;S29;T33 Transformer-2 protein homolog beta SGS*AHGS*GKS*ARHT*PAR 0.29 0.045
Kif1c O35787 S1028 Kinesin-like protein KIF1C N#S*LDGGSR 0.29 0.052
Rsrc1 Q5PPJ2 S5;S6;T8 Serine/Arginine-related protein 53 GRRS*S*DT*EEESR 0.29 0.053
Acot1 O88267 S416 Acyl-coenzyme A thioesterase 1 SHGVS*PK 0.29 0.053
Eif5b B2GUV7 S165 Eukaryotic translation initiation factor 5B DGS*EEDEDN#SK 0.29 0.053
Sptbn2 Q9QWN8 S922 Spectrin beta chain, non-erythrocytic 2 AS*PPGKDR 0.29 0.058
Rbm5 B2GV05 S37 RNA-binding protein 5 RDS*DYK 0.29 0.058
Ppig O55035 S629 Peptidyl-prolyl cis-trans isomerase G SS*EREESQSR 0.29 0.061
Prkd1 Q9WTQ1 S231;S234 Serine/threonine-protein kinase D1 TASAEFSTSAPDEPLLS*PVS*PGFEQK 0.28 0.002
Crtc1 Q157S1 S151 CREB-regulated transcription coactivator 1 TNS*DSALHQSTMTPTQ#AESFTGGPQDAHQK 0.28 0.002
Arfgef2 Q7TSU1 S218 Brefeldin A-inhibited guanine nucleotide-exchange protein 2 ELEKPIQSKPQS*PVIQATAGSPK 0.28 0.003
Ptpn21 Q62728 S700 Tyrosine-protein phosphatase non-receptor type 21 KS*LSDATMLIHSSEEDEDLEDDSSR 0.28 0.003
Gprc5c Q3KRC4 S402;S405 G-protein coupled receptor family C group 5 member C ATANSQVMGS*ANS*TLR 0.28 0.004
Kcnh1 Q63472 S860 Potassium voltage-gated channel subfamily H member 1 S*DLRLDN#VGEARSPQ#DR 0.28 0.005
Dcaf11 Q5M9G8 S6 DDB1- and CUL4-associated factor 11 NS*SSAGSGSLEPSEGLSR 0.28 0.006
Fam234a Q5M7W6 S21 Protein FAM234A KS*QENLGNLPK 0.28 0.008
Tmem100 Q569C0 S121 Transmembrane protein 100 RES*QTALVVNQR 0.28 0.008
Ric8a Q80ZG1 T515;S526 Synembryn-A GHLTSLQDAMC^ET*MEGQ#LS?SDPDS*DPD 0.28 0.009
Dnmt1 Q9Z330 S138;S140 DNA (cytosine-5)-methyltransferase 1 S*KS*DSETMIEASSSSVATR 0.28 0.013
Map1b P15205 S1470 Microtubule-associated protein 1B KAS*DAEIMSSQSALALDER 0.28 0.014
Smarcad1 D3Z9Z9 S799 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 L$KEM@S*Q#LMLK 0.28 0.016
Rab11fip1 Q3B7T9 S410 Rab11 family-interacting protein 1 SMSLPSYRPLTTADS*R 0.28 0.016
Cdc25a P48965 S34;T46 M-phase inducer phosphatase 1 VQFGAS*RAGGLSPVTNLT*VTMDQLEGLGS?DYEKPMDVR 0.28 0.019
Myadm Q6VBQ5 T13 Myeloid-associated differentiation marker TTITTT*SSSSTTVGSAR 0.28 0.019
Iws1 Q3SWT4 S277 Protein IWS1 homolog EKPES*EDS?DGENKREDSEVQN#ESDGHADR 0.28 0.021
Phf10 Q4V7A6 S296;S300 PHD finger protein 10 YLPLNTALYEPPLDPELPALDS*DGDS*DDGEDGGGDEK 0.28 0.022
Acbd5 A0FKI7 S403 Acyl-CoA-binding domain-containing protein 5 QVGS*GGDGER 0.28 0.031
Mre11 Q9JIM0 S275 Double-strand break repair protein MRE11 NEQQLFYVSQPGSSVVTALS*PGETVK 0.28 0.031
Ufl1 B2GV24 S789 E3 UFM1-protein ligase 1 SS*VTEE 0.28 0.047
Hdgf Q8VHK7 S133 Hepatoma-derived growth factor GN#AEGSS*DEEGK 0.28 0.059
Axin1 O70239 S492 Axin-1 S*PDSGHVAK 0.28 0.062
Ppig O55035 S694 Peptidyl-prolyl cis-trans isomerase G QSS*QDNEVK 0.28 0.065
Hdgfl3 Q923W4 S177 Hepatoma-derived growth factor-related protein 3 S*SSEGGDAGNDTR 0.28 0.068
Crebbp Q6JHU9 T264 CREB-binding protein GAGMPYPAPAMQGATSSVLAETLTQ#VSPQ#MAGHAGLNTAQAGGMT*K 0.27 9.31E-04
Git1 Q9Z272 S419 ARF GTPase-activating protein GIT1 S*MDSSDLSDGAVTLQEYLELKK 0.27 0.005
Add3 Q62847 S663 Gamma-adducin S*PDRTEEVLSPDGSPSK 0.27 0.005
Grb7 Q9QZC5 S62;S75 Growth factor receptor-bound protein 7 LREEEFQATS*LPSIPN#PFPELC^S*PPSQKPILGGSSGAR 0.27 0.005
Abcf1 Q6MG08 S193;T195;S197 ATP-binding cassette sub-family F member 1 NKPS*AT*DS*EGEDDEDMTK 0.27 0.007
Pdcl Q63737 T42 Phosducin-like protein GAPASSST*PAEAELAGEGISVNTGPK 0.27 0.007
Macf1 D3ZHV2 S33 Microtubule-actin cross-linking factor 1 SGS*LSPC^PPGDTLPWN#LPLHEQK 0.27 0.011
Itsn1 Q9WVE9 S315 Intersectin-1 SGS*GM@SVISSSSADQR 0.27 0.015
Ubr4 Q2TL32 S457 E3 ubiquitin-protein ligase UBR4 TKEGVGS*PK 0.27 0.016
Snrk Q63553 S569 SNF-related serine/threonine-protein kinase RDS*SEGPPGSEGDGGGQSKPSGGGGVDK 0.27 0.016
Ptpn21 Q62728 S670;S673;S679 Tyrosine-protein phosphatase non-receptor type 21 TFS*AGS*QSSVFS*DKVK 0.27 0.016
Phactr2 P62025 S362 Phosphatase and actin regulator 2 AGPQLLTPGQMGDSLESFS*APEDEAPR 0.27 0.019
Ckb P07335 S199 Creatine kinase B-type SMTEAEQQQ#LIDDHFLFDKPVS*PLLLASGMAR 0.27 0.02
Arfgef2 Q7TSU1 S227 Brefeldin A-inhibited guanine nucleotide-exchange protein 2 ELEKPIQSKPQSPVIQATAGS*PK 0.27 0.024
Map4k3 Q924I2 S486 Mitogen-activated protein kinase kinase kinase kinase 3 DGS*VHQQQSEQR 0.27 0.026
Itpkb P42335 S24;T32 Inositol-trisphosphate 3-kinase B SGS*PLPSGSET*PQPSGR 0.27 0.026
Macf1 D3ZHV2 S33;S35 Microtubule-actin cross-linking factor 1 SGS*LS*PC^PPGDTLPWNLPLHEQK 0.27 0.031
Apc P70478 S2817;S2829 Adenomatous polyposis coli protein RDS*KTDSTESSGAQS*PK 0.27 0.036
Pgrmc1 P70580 Y180 Membrane-associated progesterone receptor component 1 EGEEPTVY*SDDEEPKDEAAR 0.27 0.038
Hmga1 Q8K585 S99;S103 Zinc finger Ran-binding domain-containing protein 2 EEEEGIS*QESS*EEEQ 0.27 0.038
Nhej1 Q6AYI4 S22 Non-homologous end-joining factor 1 M$EELEQGLLM@QPWAWLQ#LAENS*LLAK 0.27 0.038
Oxr1 Q4V8B0 S83 Oxidation resistance protein 1 RMS*FQKPK 0.27 0.041
Nucks1 Q9EPJ0 T202;S214 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 EKT*PSPKEEDEEAES*PPEK 0.27 0.047
Hnrnpa1 P04256 S6 Heterogeneous nuclear ribonucleoprotein A1 SES*PKEPEQ#LR 0.27 0.053
Tor1aip2 Q6P752 S104 Torsin-1A-interacting protein 2 SPS*SQ#DTEQR 0.27 0.061
Tra2b P62997 Y68;S71;S73 Transformer-2 protein homolog beta HY*TRS*RS*R 0.27 0.071
Krcc1 Q5PPL1 S76 Lysine-rich coiled-coil protein 1 SC^S*SSQTEDR 0.27 0.087
Myo5b P70569 T1093 Unconventional myosin-Vb DEQQT*PGHR 0.27 0.088
Lsr Q9WU74 S436 Lipolysis-stimulated lipoprotein receptor S*VDALDDINRPGSTESGR 0.26 0.002
Oxr1 Q4V8B0 T334;S339 Oxidation resistance protein 1 STEESLSEDVFT*ESELS*PIREELPSSELR 0.26 0.002
Lrrc41 Q5M9H1 S326 Leucine-rich repeat-containing protein 41 S*TQESLTIGGTDSK 0.26 0.003
Nes P21263 S1166 Nestin S*IDTQEPLWSTEVAR 0.26 0.004
Tor1aip1 Q5PQX1 S203;S229 Torsin-1A-interacting protein 1 S*PRPDASIVQHIN#PFEEGETEDDLESS*YSDVTIR 0.26 0.004
Htt P51111 S389 Huntingtin SGS*IVELLAGGGSSC^SPVLSR 0.26 0.004
Washc2 Q80X08 S342 WASH complex subunit 2 RTPADDEEDILFPPPTLTDEDFS*PFGSR 0.26 0.005
Tcf4 Q62655 S290 Transcription factor 4 N#GGQASSS*PNYEGPLHSLQSR 0.26 0.005
Arhgap27 Q6TLK4 S620 Rho GTPase-activating protein 27 LGS*WKEEDVRPN#AASPSLNPGSQESDLSR 0.26 0.005
Aqp4 P47863 S285 Aquaporin-4 S*QVETEDLILKPGVVHVIDIDR 0.26 0.007
Plec P30427 T4626 Plectin GYYSPYSVSGSGST*AGSR 0.26 0.008
Coro7 O35828 S876 Coronin-7 TPS*SAQYLEEK 0.26 0.009
Zdhhc5 Q2THW7 S427;S432 Palmitoyltransferase ZDHHC5 S*SSLKS*AQGTGFELGQLQSIR 0.26 0.012
Afdn O35889 S1179;S1189;S1194 Afadin S*SPNVANQPPS*PGGKS*PYTSGTAAK 0.26 0.013
Trim28 O08629 S595;S599;S601 Transcription intermediary factor 1-beta LAS*PSGS*TS*SGLEVVAPEVTSAPVSGPGILDDSATIC^R 0.26 0.013
Cdc42bpb Q7TT49 S1685;S1692;S1695 Serine/threonine-protein kinase MRCK beta HSTPSNSS*NPSGPPS*PNS*PHR 0.26 0.013
Pi4ka O08662 S250;S251;S259 Phosphatidylinositol 4-kinase alpha KTS*S*VSSISQVS*PER 0.26 0.014
Mef2d O89038 S121 Myocyte-specific enhancer factor 2D AS*EELDGLFR 0.26 0.015
Grip1 P97879 S769;S772 Glutamate receptor-interacting protein 1 LPIPS*HSS*DLGDGEEDPSPIQRPGK 0.26 0.016
Slc38a1 Q9JM15 S52 Sodium-coupled neutral amino acid transporter 1 S*LTN#SHLEK 0.26 0.023
Oxr1 Q4V8B0 S195;T196;S197 Oxidation resistance protein 1 VVSS*T*S*EEEEAFTEK 0.26 0.026
Cd2ap F1LRS8 S458 CD2-associated protein S*VDLDALVAR 0.26 0.026
Akt2 P47197 S461 RAC-beta serine/threonine-protein kinase YDSLGS*LELDQR 0.26 0.026
Arhgap24 Q5U2Z7 S573 Rho GTPase-activating protein 24 S*STTTC^PEQDFYGGNFEDPVLDGPPQDDLSHPGDYENK 0.26 0.029
Ptger1 P70597 S265;S267;S268 Prostaglandin E2 receptor EP1 subtype LAS*AS*S*ASSITSTTAALR 0.26 0.034
Pex19 Q9QYU1 S54 Peroxisomal biogenesis factor 19 RS*PGDTAK 0.26 0.045
Map2 P15146 S1829;S1832;S1842 Microtubule-associated protein 2 RLS*NVS*S?SGSINLLES*PQLATLAEDVTAALAK 0.26 0.047
Nifk Q5RJM0 T213 MKI67 FHA domain-interacting nucleolar phosphoprotein EISSIANTHGDSEANQDPT*PVC^T?PTFLER 0.26 0.047
Vdac2 P81155 S116 Voltage-dependent anion-selective channel protein 2 LTFDTTFS*PNTGK 0.26 0.051
Sarg Q499V8 S511;S515 Specifically androgen-regulated gene protein SGVGLSSYLSAAEKDPGGQ#TSTS*LGKS*PFLDK 0.26 0.054
Rnps1 Q6AYK1 S155;S157 RNA-binding protein with serine-rich domain 1 RS*PS*PKPTK 0.26 0.065
Casc3 Q8K3X0 S124 Protein CASC3 SEANDAADSS*AK 0.26 0.072
Pard3 Q9Z340 S667 Partitioning defective 3 homolog SMS*TEGNK 0.26 0.086
Ubr4 Q2TL32 S2722;T2724 E3 ubiquitin-protein ligase UBR4 S*N#T*PMGDKDDDDDDDADEK 0.26 0.086
Clec2d11 Q0H8B9 S7 C-type lectin domain family 2 member D11 KAS*QPMLNTTGSLQEGEM@GK 0.25 7.38E-04
Mark3 Q8VHF0 Y418 MAP/microtubule affinity-regulating kinase 3 RY*SDHAGPAIPSVVAYPK 0.25 8.67E-04
Plcl1 Q62688 S48 Inactive phospholipase C-like protein 1 S*GVALPGNAGVPADSEAGLLEAAR 0.25 0.002
Mpdz O55164 S1802;S1804;S1808;S1813 Multiple PDZ domain protein RPS*QS*SQVS*ESSLS*SFSLPR 0.25 0.004
Pdap1 Q62785 S60;S63 28 kDa heat- and acid-stable phosphoprotein KSLDS*DES*EDEDDDYQQK 0.25 0.005
Thrap3 Q5M7V8 S945 Thyroid hormone receptor-associated protein 3 FSGEEGEIEDDES?GTENREEKDS*LQPSAE 0.25 0.006
Arhgap27 Q6TLK4 S620;S632 Rho GTPase-activating protein 27 LGS*WKEEDVRPNAAS*PSLNPGSQESDLSR 0.25 0.006
Dhx30 Q5BJS0 S226 Putative ATP-dependent RNA helicase DHX30 GGS*FEMTDDDSAIR 0.25 0.007
Arhgap27 Q6TLK4 S195 Rho GTPase-activating protein 27 S*DSENVYEAIPDLR 0.25 0.009
Pllp P47987 S13;S14 Plasmolipin TS*S*PAQGVGASVSAMRPDLGFVR 0.25 0.01
Rapgef2 F1M386 S960 Rap guanine nucleotide exchange factor 2 SS*FLNAK 0.25 0.011
Anxa2 Q07936 Y24 Annexin A2 LSLEGDHSTPPSAY*GSVKPYTNFDAER 0.25 0.014
Itpr2 P29995 S1709 Inositol 1,4,5-trisphosphate receptor type 2 GDHS*VGVN#GPLSGAYAK 0.25 0.014
Arhgef6 Q5XXR3 S640 Rho guanine nucleotide exchange factor 6 KTS*EEEYVIR 0.25 0.015
Macf1 D3ZHV2 S5324 Microtubule-actin cross-linking factor 1 TS*LAGDTSNSSSPASTGAK 0.25 0.018
Tmem79 Q3T1H8 S21 Transmembrane protein 79 DTEISEKS*PPQASVLQPEEEGGTESPGAESLR 0.25 0.018
Usp10 Q3KR59 T568;S572 Ubiquitin carboxyl-terminal hydrolase 10 HSVSN#GPGSHLIEDEELEDT*GEGS*EDEWEQ#VGPK 0.25 0.019
Lsr Q9WU74 S473 Lipolysis-stimulated lipoprotein receptor S*RDDLYDPDDPR 0.25 0.021
Ppp1r1a P19103 S43;S46;S47 Protein phosphatase 1 regulatory subunit 1A RPTPATLVLTS*DQ#S*S*PEVDEDRIPNPLLK 0.25 0.025
Hp1bp3 Q6P747 S70;S76;T77 Heterochromatin protein 1-binding protein 3 LAEGEEEKPEPDGS*SEESIS*T*VEEPENETPPAPSR 0.25 0.025
Copg2 D4ABY2 T596 Coatomer subunit gamma-2 SEITLVT*PKPEK 0.25 0.025
Ddx21 Q3B8Q1 S9;S11 Nucleolar RNA helicase 2 SAS*KS*ESEGTEESMETLQKPSEK 0.25 0.026
Ralgapa1 O55007 S1003 Ral GTPase-activating protein subunit alpha-1 SQTPS*PSTLNIDHM@EQK 0.25 0.027
Cast P27321 S44 Calpastatin KGS*DEVTASSAATGTSPR 0.25 0.027
Paf1 Q4V886 S394;S409 RNA polymerase II-associated factor 1 homolog EAGGS*DEEHEKGS?S?SEKEGS*EDER 0.25 0.03
Stx12 G3V7P1 S139;S142 Syntaxin-12 AGS*RLS*AEDR 0.25 0.031
Retreg2 Q3MHU5 T274;S276;S278 Reticulophagy regulator 2 NAPPAGDEPLAET*ES*ES*EAELAGFSPVVDVK 0.25 0.034
Plcb4 Q9QW07 S503 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 SMMEAGESAAPASILEDDNEEEIES*ADQEEEAHPEYK 0.25 0.036
Usp16 Q2KJ09 S414 Ubiquitin carboxyl-terminal hydrolase 16 TMEEEDKDS*EEEKDDSYMK 0.25 0.037
Map2 P15146 S1829;S1832 Microtubule-associated protein 2 RLS*NVS*SSGSINLLES?PQ#LAT?LAEDVTAALAK 0.25 0.039
Prrc2a Q6MG48 S1088;S1095 Protein PRRC2A TAS*ETRS?EGS*EYEEIPK 0.25 0.039
Tsc2 P49816 S1341;S1343;S1344 Tuberin HC^QRPDAY?SRSSS*AS*S*QEEK 0.25 0.04
Zdhhc5 Q2THW7 S401;S409 Palmitoyltransferase ZDHHC5 SEPS*LEPESFRS*PTFGK 0.25 0.044
Arfgef2 Q7TSU1 S621;S624;S627;T628 Brefeldin A-inhibited guanine nucleotide-exchange protein 2 RC^S*VTS*VES*T*VSSGTQTAIPDDPEQFEVIK 0.25 0.048
Map2 P15146 S1682 Microtubule-associated protein 2 IGS*TDNIK 0.25 0.049
Rtn3 Q6RJR6 S462;S464 Reticulon-3 S*DS*LPSAAVK 0.25 0.051
Map2 P15146 S1816;S1821;S1824 Microtubule-associated protein 2 VDHGAEIITQ#S*PSRS?S*VAS*PR 0.25 0.054
Rtn4 Q9JK11 S295 Reticulon-4 DLAEFSELEYSEMGSSFKGS*PK 0.25 0.058
Thrap3 Q5M7V8 S184;S187;S190 Thyroid hormone receptor-associated protein 3 KSSS*KDS*RPS*QAAGDNQGDEAK 0.25 0.062
Fmr1 Q80WE1 S347 Synaptic functional regulator FMR1 VGS*NSSEEK 0.25 0.066
Prpf4b Q5RKH1 S258 Serine/threonine-protein kinase PRP4 homolog ARS*PADEK 0.25 0.076
Zbtb38 Q5EXX3 S939 Zinc finger and BTB domain-containing protein 38 GSRS*PVGR 0.25 0.086
Atrx P70486 S177 Transcriptional regulator ATRX (Fragment) GESC^DS*SEDK 0.25 0.086
Hdac1 Q4QQW4 S434 Histone deacetylase 1 NS*SNFK 0.25 0.089
Zdhhc5 Q2THW7 S593 Palmitoyltransferase ZDHHC5 RS*PLSK 0.25 0.093
Casc3 Q8K3X0 S65 Protein CASC3 RVES*GGAK 0.25 0.094
Myo9a Q9Z1N3 S1308;S1318 Unconventional myosin-IXa RWS*TELMPEGLQ#S*PQGTPDSESSQGSLELLTC^DENQK 0.24 7.49E-05
Git1 Q9Z272 S570 ARF GTPase-activating protein GIT1 GVS*ASSVTFTPSSPLLSSSQEGSR 0.24 0.001
Map2 P15146 T1814;S1821;S1824 Microtubule-associated protein 2 VDHGAEIIT*QSPSRSS*VAS*PR 0.24 0.003
Farp1 F1LYQ8 S876;S882;S898 FERM, RhoGEF and pleckstrin domain-containing protein 1 SN#GPTPELLASS*PPDNKS*PDEATAADQESEDDLS*ASR 0.24 0.004
Aldh1l1 P28037 S309 Cytosolic 10-formyltetrahydrofolate dehydrogenase GS*ASSDLELTEAELATAEAVR 0.24 0.005
Dlg1 Q62696 S122;S138 Disks large homolog 1 IS*PQVPNEVLGPELVHVS*EK 0.24 0.006
Wnk1 Q9JIH7 T1989 Serine/threonine-protein kinase WNK1 GT*FTDDLHK 0.24 0.006
Zc3hav1 Q8K3Y6 S667 Zinc finger CCCH-type antiviral protein 1 RLS*TPSYEEKPLSAVFATK 0.24 0.006
Vapa Q9Z270 S166 Vesicle-associated membrane protein-associated protein A QDGPLPKPHSVS*LNDTETR 0.24 0.008
Pard3 Q9Z340 S852 Partitioning defective 3 homolog S*MDLGIADETK 0.24 0.011
Scfd1 Q62991 S311 Sec1 family domain-containing protein 1 KS*YDLTPVDK 0.24 0.011
Slc4a1 P23562 S222;S226 Band 3 anion transport protein LYC^AQAEGGS*EEPS*PSGILK 0.24 0.014
Apc P70478 S2569 Adenomatous polyposis coli protein TGS*SSSILSASSESSEK 0.24 0.018
Hp1bp3 Q6P747 T85 Heterochromatin protein 1-binding protein 3 LAEGEEEKPEPDGSSEESISTVEEPEN#ET*PPAPSR 0.24 0.02
Mpdz O55164 S1571 Multiple PDZ domain protein KDS*SQTPAVPAPDLEPIPSTSR 0.24 0.02
Nf1 P97526 S878 Neurofibromin KGS*MISVMSSEGNVDSPVSR 0.24 0.022
Hnrnph1 Q8VHV7 S54 Heterogeneous nuclear ribonucleoprotein H EGRPS*GEAFVELESEDEVK 0.24 0.03
Mknk1 Q4G050 S168;S173 MAP kinase-interacting serine/threonine-protein kinase 1 DLKPENILC^ES*PEKVS*PVK 0.24 0.031
Sh3kbp1 Q925Q9 S546;S547 SH3 domain-containing kinase-binding protein 1 RPPSQ#SLTSSSLS*S*PDIFDSPSPEEDKEEHISLAHR 0.24 0.037
Glyr1 Q5RKH0 S130 Putative oxidoreductase GLYR1 KLS*LSEGK 0.24 0.04
Rtn1 Q64548 S348 Reticulon-1 GS*VSEDELIAAIK 0.24 0.041
Fnbp1l Q2HWF0 S488;S501 Formin-binding protein 1-like RHS*SDINHLVTQGRES*PEGS?YTDDANQEVR 0.24 0.047
Cpd Q9JHW1 T1366;T1368 Carboxypeptidase D KSLLSHEFQDET*DT*EEETLYSSK 0.24 0.05
Map2k1 Q01986 T386 Dual specificity mitogen-activated protein kinase kinase 1 RSDAEEVDFAGWLC^STIGLNQPST*PTHAASI 0.24 0.056
Mtdh Q9Z1W6 S425 Protein LYRIC SQEPISN#DQKDS*DDDKEK 0.24 0.062
Tra2b P62997 S29;T33 Transformer-2 protein homolog beta S*ARHT*PAR 0.24 0.074
Rplp2 P02401 S105 60S acidic ribosomal protein P2 EESEES*DDDMGFGLFD 0.24 0.076
Gprc5c Q3KRC4 S434 G-protein coupled receptor family C group 5 member C ISQDQS*PK 0.24 0.103
Nolc1 P41777 S318 Nucleolar and coiled-body phosphoprotein 1 SVGAQS*PK 0.24 0.103
Zfyve26 D4A8G9 S1891 Zinc finger FYVE domain-containing protein 26 DAPEESPC^QSEVPDS*AKNESPSYSAVVR 0.23 4.22E-04
Tle3 Q9JIT3 S197;T198 Transducin-like enhancer protein 3 E$RESS*T*NNS?VSPSESLR 0.23 5.41E-04
Arfgef1 D4A631 S393;S394 Brefeldin A-inhibited guanine nucleotide-exchange protein 1 LSVS*S*NDTQESGNSSGPSPGAK 0.23 0.001
Zdhhc5 Q2THW7 S395;Y396 Palmitoyltransferase ZDHHC5 HPS*Y*RSEPSLEPESFRSPT?FGK 0.23 0.003
Dync1li2 Q62698 S194 Cytoplasmic dynein 1 light intermediate chain 2 DFQDYIEPEEGC^Q#GS*PQRR 0.23 0.003
Eif5b B2GUV7 S66 Eukaryotic translation initiation factor 5B ELEELS*LEAQGIGADR 0.23 0.003
H2afy Q02874 S169 Core histone macro-H2A.1 AAS*ADSTTEGAPTDGFTVLSTK 0.23 0.004
Golim4 Q5BJK8 Y467 Golgi integral membrane protein 4 QQAHSDAVENDVAQGAEDQGIPEEEGGAY*DR 0.23 0.007
Spin1 Q4V8J7 S124 Spindlin-1 IS*DAHLADTMIGK 0.23 0.01
Ccdc8 P62521 S237 Coiled-coil domain-containing protein 8 HS*HTSPDLDDSSR 0.23 0.011
Rbm10 P70501 S719 RNA-binding protein 10 AHLS*ENELEALEK 0.23 0.011
Cdk17 O35831 S180 Cyclin-dependent kinase 17 AS*LSEIGFGK 0.23 0.012
Map1b P15205 T1923 Microtubule-associated protein 1B TTKT*PEDGGYSC^EITEK 0.23 0.013
Map2 P15146 S825 Microtubule-associated protein 2 LAS*VSADAEVAR 0.23 0.013
Tor1aip1 Q5PQX1 S228;S229;S231 Torsin-1A-interacting protein 1 SPRPDASIVQHIN#PFEEGETEDDLES*S*YS*DVTIR 0.23 0.015
Lsr Q9WU74 S436;S455 Lipolysis-stimulated lipoprotein receptor S*VDALDDINRPGSTESGRSS*PPSSGR 0.23 0.016
Clip1 Q9JK25 S194;S203 CAP-Gly domain-containing linker protein 1 TASES*ISNLSEAGS*VK 0.23 0.017
Creb1 P15337 T104;S108 Cyclic AMP-responsive element-binding protein 1 LFSGTQIST*IAES*EDSQESVDS?VTDSQK 0.23 0.018
Polr2m Q91XQ4 S266 DNA-directed RNA polymerase II subunit GRINL1A GQS*PASSEEHR 0.23 0.019
Ptbp1 Q00438 S16 Polypyrimidine tract-binding protein 1 RGS*DELFSTC^VSN#GPFIMSSSASAAN#GNDSK 0.23 0.02
Chd8 Q9JIX5 S1997;S2008 Chromodomain-helicase-DNA-binding protein 8 TASPS*PLRPDVPAEKS*PEEN#AVQVPSLDSLTLK 0.23 0.021
Hdgf Q8VHK7 S107 Hepatoma-derived growth factor KS*C^AEEPEVEPEAHEGDGDK 0.23 0.022
Wls Q6P689 S512 Protein wntless homolog NYGEDQ#SNGDLGVHS*GEELQ#LTTTITHVDGPTEIYK 0.23 0.022
Eif5b B2GUV7 S9;T17 Eukaryotic translation initiation factor 5B NKS*EDSTKDDT*DLGALAAEIEGAGAAK 0.23 0.026
Slk O08815 S340;S344;S347 STE20-like serine/threonine-protein kinase RAS*SDLS*IAS*SEEDK 0.23 0.026
Atrx P70486 S307;S316 Transcriptional regulator ATRX (Fragment) QADITSSSS*DIGDDDQNS*AGEES?SDEQK 0.23 0.028
Zc3hav1 Q8K3Y6 S262;S266;S270;S274 Zinc finger CCCH-type antiviral protein 1 FLHNSLEFLS*PVVS*PLGS*GPPS*PDVTSC^K 0.23 0.029
Fbxo46 Q4KLY2 S273;S293 F-box only protein 46 EPQ#S*PDGSLAN#GGGGRPAC^PYPGS*PGPGTR 0.23 0.029
Clip1 Q9JK25 S194;S199;S203 CAP-Gly domain-containing linker protein 1 TASES*ISNLS*EAGS*VK 0.23 0.033
Mdm1 Q5PQN4 S266 Nuclear protein MDM1 GNSSFEILS*PEKK 0.23 0.033
Cast P27321 S280;S281 Calpastatin N#EAITGPLPDSPKPM@GIDHAIDALSSDFTC^S*S*PTGK 0.23 0.033
Mdm1 Q5PQN4 S283;S286 Nuclear protein MDM1 KADEPLDLEVDMAS*EDS*DQPIK 0.23 0.04
Grb7 Q9QZC5 S65;S86 Growth factor receptor-bound protein 7 LREEEFQATSLPS*IPNPFPELC^SPPSQKPILGGS*SGAR 0.23 0.043
Ptpn21 Q62728 S673;S676;S679 Tyrosine-protein phosphatase non-receptor type 21 TFSAGS*QSS*VFS*DK 0.23 0.043
Rtn4 Q9JK11 S685;S689 Reticulon-4 ETKLS*TEPS*PDFSNYSEIAK 0.23 0.044
Slc12a7 Q5RK27 S30;T40 Solute carrier family 12 member 7 TEEPGS*PESADPAC^PT*PGDGNPR 0.23 0.046
Git1 Q9Z272 S384;S394;S397;T401 ARF GTPase-activating protein GIT1 NQS*DLDDQHDYDS*VAS*DEDT*DQEPLPSAGATR 0.23 0.053
Sh3rf1 Q71F54 S743;S747 E3 ubiquitin-protein ligase SH3RF1 VS*PPAS*PTLDVELGSGEVPLQGAVGPELPLGGVHGR 0.23 0.054
Trim28 O08629 S595;S597;T600 Transcription intermediary factor 1-beta LAS*PS*GST*SSGLEVVAPEVTSAPVSGPGILDDSATIC^R 0.23 0.062
Phactr2 P62025 S229 Phosphatase and actin regulator 2 GELS*DTGVESLKPEETVAGAEEEATGKPK 0.23 0.07
Exoc4 Q62824 S32 Exocyst complex component 4 TLS*TSDDVEDR 0.23 0.071
Krt18 Q5BJY9 S391 Keratin, type I cytoskeletal 18 LLEDGDDFSLNDALDS*SN#SM@QTVQR 0.23 0.071
Vdac3 Q9R1Z0 T4 Voltage-dependent anion-selective channel protein 3 C$^ST*PTYC^DLGK 0.23 0.077
Dync1li1 Q9QXU8 T512 Cytoplasmic dynein 1 light intermediate chain 1 KPASVSPT*TPPSPT?EGEAS 0.23 0.077
Fto Q2A121 S253 Alpha-ketoglutarate-dependent dioxygenase FTO SAVAVYSYSC^EGSEDES*DDESSFEGR 0.23 0.078
Gnl1 Q6MG06 T48;S51 Guanine nucleotide-binding protein-like 1 EEQT*DTS*DGESVTHHIR 0.23 0.087
Camkk2 O88831 S132;S136 Calcium/calmodulin-dependent protein kinase kinase 2 C^IC^PSLSYS?PASS*PQSS*PR 0.23 0.089
Cttn Q66HL2 T364;S368;S381 Src substrate cortactin KQ#T*PPAS*PSPQPAEDRPPSS*PIYEDAAPLK 0.23 0.094
Pygl P09811 S842 Glycogen phosphorylase, liver form ESS*N#GVN#ANGK 0.23 0.097
Phrf1 Q63625 S1194 PHD and RING finger domain-containing protein 1 HPHS*PEK 0.23 0.13
Lrrc8d Q5U308 T240 Volume-regulated anion channel subunit LRRC8D HVST*SSDEGSPSASTPMINK 0.22 2.11E-04
Tmem55a Q4V888 S16;T22 Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase SPLLSAS*HSGNVT*PTAPPYLQES?SPR 0.22 9.95E-04
Prkd2 Q5XIS9 S211 Serine/threonine-protein kinase D2 LGS*SESLPC^TAEELSR 0.22 0.001
Prkd1 Q9WTQ1 S203 Serine/threonine-protein kinase D1 LS*NVSLTGLGTVR 0.22 0.003
Sytl5 Q812E4 S211 Synaptotagmin-like protein 5 SYS*LDLDNQNLQSFK 0.22 0.004
Phactr2 P62025 S377;S379 Phosphatase and actin regulator 2 EYQAN#DS*DS*DGPILYTDDDDEEDDDDDSTGESALASK 0.22 0.004
Pou2f1 P31503 S251 POU domain, class 2, transcription factor 1 (Fragment) WLNDAENLSSDSTASS*PSALNSPGLGAEGLNR 0.22 0.004
Gps1 P97834 S454;T459 COP9 signalosome complex subunit 1 EGS*QGELT*PAN#SQSR 0.22 0.005
Lsr Q9WU74 S375;S379 Lipolysis-stimulated lipoprotein receptor AMS*EVTS*LHEDDWR 0.22 0.007
Lrrfip1 Q66HF9 T405 Leucine-rich repeat flightless-interacting protein 1 GSFEPRPDHVLGQT*PEIDK 0.22 0.007
Map1a P34926 T1923 Microtubule-associated protein 1A DTEQTEPEQREPT*PYPDER 0.22 0.007
Stk3 O54748 S15 Serine/threonine-protein kinase 3 LS*EDSLTK 0.22 0.008
Rmdn3 Q66H15 S46 Regulator of microtubule dynamics protein 3 SQS*LPN#SLDYAQTSER 0.22 0.008
Akap12 Q5QD51 S614 A-kinase anchor protein 12 RPS*ESDKEEELEK 0.22 0.009
Snx16 P57769 S29 Sorting nexin-16 SSS*FGSVSTSSNSSK 0.22 0.01
Slk O08815 S340;S341 STE20-like serine/threonine-protein kinase RAS*S*DLSIASSEEDK 0.22 0.011
Limk2 P53670 S289;S293 LIM domain kinase 2 SNS*ISKS*PGPS?SPKEPLLLSR 0.22 0.011
Abcc1 Q8CG09 S916;S920;S931 Multidrug resistance-associated protein 1 HLS*NS?SS*HSVVTNQQHSS*TAELQK 0.22 0.013
Sptan1 P16086 S1031 Spectrin alpha chain, non-erythrocytic 1 LDPAQSAS*RENLLEEQGSIALR 0.22 0.013
Sorbs2 O35413 S252 Sorbin and SH3 domain-containing protein 2 S*HSDN#GTDAFK 0.22 0.015
Pgd P85968 T35 6-phosphogluconate dehydrogenase, decarboxylating T*VSKVDDFLAK 0.22 0.016
Camsap1 D3Z8E6 S1429 Calmodulin-regulated spectrin-associated protein 1 VES*LEALPILSR 0.22 0.017
Usp10 Q3KR59 S224 Ubiquitin carboxyl-terminal hydrolase 10 TC^DSPQNPMDLISDPVPDS*PFPR 0.22 0.023
Arhgap27 Q6TLK4 S632 Rho GTPase-activating protein 27 EEDVRPN#AAS*PSLNPGSQESDLSR 0.22 0.023
Gab2 Q9EQH1 T621 GRB2-associated-binding protein 2 KPST*S?S?VTSDEKVDYVQVDK 0.22 0.025
Mdc1 Q5U2M8 S350 Mediator of DNA damage checkpoint protein 1 GVAHLQ#DS*PTGS?DTDVEEDKTALAAPPER 0.22 0.026
Atxn10 Q9ER24 S352 Ataxin-10 DSTNIFS*PSDSLK 0.22 0.029
Map2 P15146 S1604;S1614 Microtubule-associated protein 2 SGTSTPTTPGS*TAITPGTPPS*YSSR 0.22 0.03
Ddx21 Q3B8Q1 S9;S11;T16 Nucleolar RNA helicase 2 SAS*KS*ESEGT*EESMETLQKPSEK 0.22 0.037
Hdgf Q8VHK7 S206 Hepatoma-derived growth factor N#STPSEPDS*GQ#GPPPEEEEGEEEAAKEEAEAQGVR 0.22 0.037
Smarcad1 D3Z9Z9 S210;S211;S212 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 KLS*S*S*SEAYEEDEAN#DDQSLK 0.22 0.042
Specc1l Q2KN99 S833 Cytospin-A RSS*TSSEPTPTVK 0.22 0.043
Akap12 Q5QD51 S736 A-kinase anchor protein 12 EAGTDAVPASTQ#EQDQAQGSSSPEPAGS*PSEGEGVSTWESFK 0.22 0.043
Cd44 P26051 S467 CD44 antigen S*QEMVHLVNK 0.22 0.045
Cast P27321 S260 Calpastatin N#EAITGPLPDS*PKPMGIDHAIDALSSDFTC^SSPTGK 0.22 0.048
Psip1 Q812D1 T271;S272;S274 PC4 and SFRS1-interacting protein NLAKPGVTST*S*DS*EEDDDQEGEK 0.22 0.05
Ilf2 Q7TP98 T461 Interleukin enhancer-binding factor 2 KEGEEEEENTEEPPQ#GEEEESM@ET*QE 0.22 0.05
Hmga1 Q8K585 T53 High mobility group protein HMG-I/HMG-Y EPSEVPT*PK 0.22 0.05
Ralgapa1 O55007 S366 Ral GTPase-activating protein subunit alpha-1 TAEPEQS*HSN#TS?TLTER 0.22 0.053
Specc1l Q2KN99 S385 Cytospin-A KGS*SGNASEVSVAC^LTER 0.22 0.053
Grip1 P97879 S769;S772;S782 Glutamate receptor-interacting protein 1 KLPIPS*HSS*DLGDGEEDPS*PIQRPGK 0.22 0.055
Fnbp1l Q2HWF0 S488 Formin-binding protein 1-like HS*SDINHLVTQGR 0.22 0.061
Canx P35565 S553;S563 Calnexin S*DAEEDGGTGS*QDEEDSKPK 0.22 0.072
Vdac1 Q9Z2L0 S104 Voltage-dependent anion-selective channel protein 1 LTFDSSFS*PNTGK 0.22 0.087
Nos1ap O54960 S190 Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein NSDGS*GDPGR 0.22 0.091
Hdgf Q8VHK7 S132 Hepatoma-derived growth factor GNAEGS*SDEEGK 0.22 0.092
Smarcad1 D3Z9Z9 S39;S50 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 IEEAPEAAPQPSQPGPS?S?PISLS*AEEENAEGEVS*R 0.22 0.111
Ptbp1 Q00438 S140 Polypyrimidine tract-binding protein 1 TDSS*PN#QAR 0.22 0.114
Arhgap24 Q5U2Z7 S402;S406 Rho GTPase-activating protein 24 TNS*PRNS*IHK 0.22 0.116
Trip12 F1LP64 S1063 E3 ubiquitin-protein ligase TRIP12 S*PTTTQSPK 0.22 0.116
Canx P35565 S553 Calnexin QKS*DAEEDGGTGS?QDEEDSKPK 0.22 0.122
Zc3h18 Q6TQE1 S837 Zinc finger CCCH domain-containing protein 18 DRQS*PPAK 0.22 0.128
Ncoa2 Q9WUI9 S736 Nuclear receptor coactivator 2 QEPAS*PKK 0.22 0.131
Rsrc1 Q5PPJ2 S5;S6 Serine/Arginine-related protein 53 GRRS*S*DT?EEESR 0.22 0.139
Sharpin Q9EQL9 S307 Sharpin EVSGHS*PQHSK 0.22 0.14
Vcl P85972 S456 Vinculin GDS*PEAR 0.22 0.143
Thoc5 Q68FX7 T19 THO complex subunit 5 homolog SDGT*PTEGK 0.22 0.144
Fam129b B4F7E8 S683;S697 Niban-like protein 1 GLLAQDLQAESS?PPASPLLNGAPVQ#ES*PQPM@TVLEASPPAS*PLR 0.22 0.168
Prkd1 Q9WTQ1 S203;S206 Serine/threonine-protein kinase D1 RLS*NVS*LTGLGTVR 0.21 0.001
Oxr1 Q4V8B0 S194;T196;S197 Oxidation resistance protein 1 VVS*ST*S*EEEEAFTEK 0.21 0.001
Inppl1 Q9WVR3 S145 Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 S*GSTSISVPAGPSS?PLPAPETPTTPAAESTPN#GLSTVSHEYLK 0.21 0.002
Macf1 D3ZHV2 S5372;T5389;S5390 Microtubule-actin cross-linking factor 1 RGS*DASDFDLLETQSAC^SDT*S*ESSAAGGQGSSR 0.21 0.004
Akt1 P47196 S124;S126;S129 RAC-alpha serine/threonine-protein kinase SGS*PS*DN#S*GAEEMEVALAKPK 0.21 0.004
Anks3 Q5M9H0 S373 Ankyrin repeat and SAM domain-containing protein 3 AQGLSSEASIESNEDS*DHAR 0.21 0.004
Fam129a Q9ESN0 S578;S581 Protein Niban KHNLFEDNMALPSES*VSS*LTDLK 0.21 0.004
Map3k1 Q62925 S908 Mitogen-activated protein kinase kinase kinase 1 LS*ASSEDISDR 0.21 0.005
Eif1ad Q5RKI6 S135;S137 Probable RNA-binding protein EIF1AD ESQPELPAEPQLSGEGS*GS*EDDSDLFVNTNHR 0.21 0.007
Raf1 P11345 S29 RAF proto-oncogene serine/threonine-protein kinase DAVFDGSSC^IS*PTIVQQFGYQR 0.21 0.007
Map2 P15146 T1814;S1820;S1821;S1824 Microtubule-associated protein 2 VDHGAEIIT*QSPSRS*S*VAS*PR 0.21 0.007
Cfl1 P45592 S3 Cofilin-1 A$S*GVAVSDGVIK 0.21 0.008
Jmjd6 Q6AYK2 S381 Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 TC^S*MVGN#GDTTSQDDC^VSK 0.21 0.009
Znf148 Q62806 T305;S306 Zinc finger protein 148 GGLLTSEEDSGFST*S*PK 0.21 0.009
Pkn2 O08874 S584 Serine/threonine-protein kinase N2 ASS*LGEIDDSSELR 0.21 0.009
Ccnl1 Q9R1Q2 S353;S356 Cyclin-L1 AEEKS*PVS*INVK 0.21 0.01
Paf1 Q4V886 S394;S403;S404;S409 RNA polymerase II-associated factor 1 homolog EAGGS*DEEHEKGSS*S*EKEGS*EDER 0.21 0.01
Pkn2 O08874 T552 Serine/threonine-protein kinase N2 T*PELAPPASDSTVTK 0.21 0.012
Fam129a Q9ESN0 S580;S581 Protein Niban HNLFEDNM@ALPSESVS*S*LTDLK 0.21 0.013
Rab11fip1 Q3B7T9 S360;S361 Rab11 family-interacting protein 1 HLFS*S*TENLAAR 0.21 0.014
Macf1 D3ZHV2 S1376 Microtubule-actin cross-linking factor 1 M@IS*SSDAITQEFMDLR 0.21 0.018
Rin1 P97680 S457 Ras and Rab interactor 1 LS*TDGSLGR 0.21 0.019
Tor1aip1 Q5PQX1 S155 Torsin-1A-interacting protein 1 DAQS*LSEDRGEDEPSSQPVTSQTVSK 0.21 0.019
Hp1bp3 Q6P747 S74;S76 Heterochromatin protein 1-binding protein 3 LAEGEEEKPEPDGSS?EES*IS*TVEEPENETPPAPSR 0.21 0.02
Map4 Q5M7W5 S978 Microtubule-associated protein 4 VGS*LDN#VGHLPAGGTVK 0.21 0.021
Lrrfip2 Q4V7E8 S133;T136;S137 Leucine-rich repeat flightless-interacting protein 2 RGS*GDT*S*SLIDPDTS?LSELR 0.21 0.021
Rtkn Q6V7V2 S219 Rhotekin AS*LDSAGGSGNSPILLPTPAVGGPR 0.21 0.021
Arhgap27 Q6TLK4 S458;S459;S462 Rho GTPase-activating protein 27 KS*S*QDS*DTPAQASPPEEK 0.21 0.022
Fra10ac1 Q5FVF1 S285 Protein FRA10AC1 homolog NAGEEDSAS*DSELWK 0.21 0.023
Itpkc Q80ZG2 S211 Inositol-trisphosphate 3-kinase C LQNHPAC^PS*PEPSAGTSC^K 0.21 0.023
Map2 P15146 T1814;S1818;S1824 Microtubule-associated protein 2 VDHGAEIIT*QSPS*RS?SVAS*PR 0.21 0.023
Eif5b B2GUV7 S584;S585;S591 Eukaryotic translation initiation factor 5B DAS*S*DS?EYDS*DDDRTKEER 0.21 0.026
Ctu2 Q3B7U4 S492 Cytoplasmic tRNA 2-thiolation protein 2 GS*VSEEIQ#EYLIEEEEEEDRAEPC^EAMK 0.21 0.027
Akap12 Q5QD51 S268;S273;S274 A-kinase anchor protein 12 QEKEPTKS*PESPS*S*PVSSETTSSFK 0.21 0.029
Slc9a3r1 Q9JJ19 S288;S299 Na(+)/H(+) exchange regulatory cofactor NHE-RF1 SASS*DTSEELNAQDS*PK 0.21 0.029
Nrdc P47245 S57;S60 Nardilysin AKS*TC^S*C^PDLQ#PN#GQDLGESGR 0.21 0.03
Slc12a4 Q63632 S964;S967 Solute carrier family 12 member 4 LES*LYS*DEEDESVTGADK 0.21 0.031
Hexim1 Q5M9G1 T233;S234;S249 Protein HEXIM1 SDDT*S*DEDFVEEAGEEDGGS*DGMGGDGSEFLQR 0.21 0.031
Hnrnpk P61980 S379 Heterogeneous nuclear ribonucleoprotein K GS*YGDLGGPIITTQVTIPK 0.21 0.032
Sipa1l1 O35412 S1726;S1729 Signal-induced proliferation-associated 1-like protein 1 ASFFAASDENHRPLS*AAS*NSDQLEEQALVQMK 0.21 0.041
Pbxip1 A2VD12 S132 Pre-B-cell leukemia transcription factor-interacting protein 1 NIHPQNLPS*SPR 0.21 0.044
Map2 P15146 T1814;S1818;S1821;S1824 Microtubule-associated protein 2 VDHGAEIIT*QSPS*RSS*VAS*PR 0.21 0.045
Spns1 Q2YDU8 S506 Protein spinster homolog 1 AQLHVQGLLHETEPS*DDQIVVPQR 0.21 0.046
Tmc5 Q5M7W4 S939 Transmembrane channel-like protein 5 EVEQQS*PLHLEELDAAPDLR 0.21 0.049
Map4 Q5M7W5 S915 Microtubule-associated protein 4 VGS*TEN#MK 0.21 0.05
Grip1 P97879 S660 Glutamate receptor-interacting protein 1 KDEDNS*DEQESSGAIIYTVELK 0.21 0.055
Arhgef11 Q9ES67 S671;T676;T680 Rho guanine nucleotide exchange factor 11 S*LENPT*PPFT*PK 0.21 0.06
Arf6 P62332 S38 ADP-ribosylation factor 6 LGQS*VTTIPTVGFNVETVTYK 0.21 0.066
Pllp P47987 S9 Plasmolipin A$EFPSKVS*TR 0.21 0.068
Hsp90aa1 P82995 S263 Heat shock protein HSP 90-alpha EEKESDDKPEIEDVGS*DEEEEEK 0.21 0.068
Mink1 F1LP90 S931 Misshapen-like kinase 1 SLLLADSN#GYTN#LPDVVQPSHS?PTENSQGQS*PPTK 0.21 0.077
Arhgap27 Q6TLK4 S459 Rho GTPase-activating protein 27 KSS*QDSDTPAQ#ASPPEEK 0.21 0.078
Ubr4 Q2TL32 S362 E3 ubiquitin-protein ligase UBR4 TGS*TSSKEEDYESDAATIVQK 0.21 0.078
JPT1 Q6AXU6 S74 Hematological and neurological expressed 1 protein EDSES*PGTQ#R 0.21 0.078
Eif5 Q07205 S417 Eukaryotic translation initiation factor 5 VETVKS*DNKDDDIDIDAI 0.21 0.079
Cr1l Q63135 S531 Complement component receptor 1-like protein EDS*C^VQPQSLLTSQENNSTSSPAR 0.21 0.08
Phf10 Q4V7A6 S17;S21;S26;S35 PHD finger protein 10 RC^DS*DPAS*PGAQS*PKDDNEDNS*NDGGHPSK 0.21 0.083
Wdr70 Q5EB92 S639 WD repeat-containing protein 70 TMFAQVES*DDEESK 0.21 0.084
Fam129b B4F7E8 S668;S693;S697 Niban-like protein 1 GLLAQDLQAESS*PPASPLLNGAPVQ#ESPQ#PM@TVLEAS*PPAS*PLR 0.21 0.086
Phf10 Q4V7A6 S21;S26 PHD finger protein 10 C^DSDPAS*PGAQS*PKDDNEDNSNDGGHPSK 0.21 0.093
Stk24 B0LT89 S304 Serine/threonine-protein kinase 24 AEQSHEDSS*SEDSDVETDSQ#ASGGSDSGDWIFTIR 0.21 0.098
Cldn3 Q63400 S202;T209 Claudin-3 S*TGPGTGT*GTAYDR 0.21 0.1
Ocln Q6P6T5 S321;S326 Occludin VDS*PM@AYS*SN#GK 0.21 0.101
Ubr4 Q2TL32 S362;S365 E3 ubiquitin-protein ligase UBR4 TGS*TSS*KEEDYESDAATIVQK 0.21 0.105
Prpf4b Q5RKH1 S354;S356 Serine/threonine-protein kinase PRP4 homolog RS*LS*PK 0.21 0.112
Srek1ip1 Q5RJP9 S94 Protein SREK1IP1 RS*NSSTTEEDSSK 0.21 0.122
Myo9a Q9Z1N3 S1898 Unconventional myosin-IXa ENKEPS*PK 0.21 0.127
Rhbdf1 Q499S9 S8;S11 Inactive rhomboid protein 1 RDS*TSS*LQR 0.21 0.13
Hdgf Q8VHK7 S172 Hepatoma-derived growth factor ES*GDHEEEEK 0.21 0.133
Aak1 P0C1X8 S671;T675;S679 AP2-associated protein kinase 1 SKS*ATTT*PSGS*PR 0.21 0.136
Klf6 O35819 S192 Krueppel-like factor 6 GSGDAS*PDGR 0.21 0.145
Sigirr Q4V892 S375 Single Ig IL-1-related receptor VS*IGEGHASEMDVSDLGSR 0.2 8.12E-04
Cdk18 O35832 S109 Cyclin-dependent kinase 18 AS*LSDIGFGK 0.2 0.002
Krt8 Q10758 S475;S478;S482 Keratin, type II cytoskeletal 8 LVS*ESS*DIMS*K 0.2 0.006
Abcc5 Q9QYM0 S558 Multidrug resistance-associated protein 5 GHLLLDSDERPS*PEEEEGK 0.2 0.006
Rnpc3 Q4G055 S293 RNA-binding protein 40 DMLTVPS*PASQ#SLHPVLLPSDVFDQPQPVGNK 0.2 0.007
Nucks1 Q9EPJ0 S50;S58;S61 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 S*GKNSQ#EDS*EDS*EEK 0.2 0.008
Clasp2 Q99JD4 S947 CLIP-associating protein 2 S*QEDMSEPLK 0.2 0.012
Mark2 O08679 S408 Serine/threonine-protein kinase MARK2 S*SDQAVPAIPTSN#SYSK 0.2 0.013
Ptk2 O35346 S843 Focal adhesion kinase 1 GS*IDREDGSFQ#GPTGNQ#HIYQPVGKPDPAAPPK 0.2 0.013
N4bp3 Q3LUD3 S172 Nedd4 binding protein 3 AQLLHALS*LDEGGPEPSLSDSSSGGSFGR 0.2 0.014
Specc1l Q2KN99 S832 Cytospin-A S*STSSEPTPTVK 0.2 0.016
Pdia3 P11598 S308 Protein disulfide-isomerase A3 TFS*HELSDFGLESTTGEIPVVAIR 0.2 0.016
Cct2 Q5XIM9 S3 T-complex protein 1 subunit beta A$S*LSLAPVNIFK 0.2 0.017
Cav1 P41350 S9 Caveolin-1 YVDS*EGHLYTVPIR 0.2 0.018
Esf1 Q76MT4 T685;S686 ESF1 homolog DGAT*S*EEETELEK 0.2 0.018
Lrrc8a Q4V8I7 S202 Volume-regulated anion channel subunit LRRC8A KSS?TVS*EDVEATVPMLQR 0.2 0.019
Clasp2 Q99JD4 S374;S376 CLIP-associating protein 2 S*RS*DIDVNAAAGAK 0.2 0.022
Synj2 O55207 S1307 Synaptojanin-2 RPS*GGKPEPDDAPPVTGAVELS?SPEAPEAPSLAPK 0.2 0.025
Slc20a1 Q9JJP0 S269 Sodium-dependent phosphate transporter 1 SS*PSESPLMEK 0.2 0.029
Dstn Q7M0E3 S3 Destrin AS*GVQVADEVC^R 0.2 0.031
Git1 Q9Z272 S394 ARF GTPase-activating protein GIT1 N#QSDLDDQHDYDS*VAS?DEDTDQEPLPSAGATR 0.2 0.032
Ptk2 O35346 S843;Y861 Focal adhesion kinase 1 GS*IDREDGSFQGPTGN#QHIY*QPVGKPDPAAPPK 0.2 0.033
Tmpo Q62733 Y182;S183 Lamina-associated polypeptide 2, isoform beta QN#GSN#DSDRY*S*DNDEDSKIELK 0.2 0.033
Hp1bp3 Q6P747 S429;S441;S442 Heterochromatin protein 1-binding protein 3 KVSDGS*EDEDEEEDEEES*S*EDSEDEEPPPK 0.2 0.033
Iws1 Q3SWT4 S277;S280;S295 Protein IWS1 homolog EKPES*EDS*DGENKREDSEVQNES*DGHADR 0.2 0.034
Epb41l1 Q9WTP0 S639 Band 4.1-like protein 1 S*LPELDR 0.2 0.034
Rrad P55043 S78 GTP-binding protein RAD LDWPEGSSDS*LS?S?GDSGSEDGVYK 0.2 0.036
Strbp Q9JKU6 S470 Spermatid perinuclear RNA-binding protein VLQAMGYPTGFDADIEC^MS?SDEKS*DN#ESK 0.2 0.036
Camkk2 O88831 S494 Calcium/calmodulin-dependent protein kinase kinase 2 RS*FGNPFEGSR 0.2 0.037
Pde4a P54748 S152 cAMP-specific 3',5'-cyclic phosphodiesterase 4A SDSDYDMS*PK 0.2 0.038
Zdhhc5 Q2THW7 T348 Palmitoyltransferase ZDHHC5 DSPPT*PTMYK 0.2 0.039
Lrrfip1 Q66HF9 T82 Leucine-rich repeat flightless-interacting protein 1 NMPSLSAATLASLGGT*SSR 0.2 0.04
Plec P30427 S4625;S4629 Plectin GYYSPYSVSGSGS*TAGS*R 0.2 0.041
Pom121 P52591 S370 Nuclear envelope pore membrane protein POM 121 TSSVSS*LTSTC^TGGIPSSSR 0.2 0.043
Sytl4 Q8VHQ7 S201;S204 Synaptotagmin-like protein 4 SALEAESES*LDS*YTADSDSTSR 0.2 0.046
Lsr Q9WU74 S572 Lipolysis-stimulated lipoprotein receptor VYREEEEEEEGQYPPAPPPYSETDS*QASR 0.2 0.047
Arhgap17 Q99N37 S710 Rho GTPase-activating protein 17 C^S*SSLPPIQAPNHPPPQPPTQPR 0.2 0.049
Rhbdf1 Q499S9 S283 Inactive rhomboid protein 1 EGVLHEELSTYPDEVFES*PSEAALKDWEK 0.2 0.051
Map2k2 P36506 S76 Dual specificity mitogen-activated protein kinase kinase 2 DDDFERIS*ELGAGN#GGVVTK 0.2 0.051
Asap1 Q1AAU6 S1056 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 QAS*EDSNDLTPTLPETPVPLPR 0.2 0.053
Recql Q6AYJ1 S64 ATP-dependent DNA helicase Q1 QC^LEDSAAEASGDC^DTS*PAAWSK 0.2 0.053
Ackr3 O89039 S350;Y354 Atypical chemokine receptor 3 LIDASRVS*ETEY*SALEQNTK 0.2 0.054
Rab11a P62494 S190 Ras-related protein Rab-11A ENDMS*PSNN#VVPIHVPPTTENKPK 0.2 0.056
Gphn Q03555 S201;S207;S213 Gephyrin VKEVHDELEDLPS*PPPPLS*PPPTTS*PHK 0.2 0.057
Pdcd4 Q9JID1 S67;S68;S71;S76 Programmed cell death protein 4 NS*S*RDS*GRGDS*VSDN#GSEAVR 0.2 0.058
Smpd3 O35049 S299 Sphingomyelin phosphodiesterase 3 DGDSGSLGSPSASRES*LVK 0.2 0.058
Hdgf Q8VHK7 T200;S202;S206 Hepatoma-derived growth factor N#ST*PS*EPDS*GQ#GPPPEEEEGEEEAAK 0.2 0.062
Inpp5j Q9JMC1 S987 Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A LETVDPGGGGSWGPDQEAPDPNSLSPS*PQGR 0.2 0.065
Hspb1 P42930 S162 Heat shock protein beta-1 KYTLPPGVDPTLVSSSLS*PEGTLTVEAPLPK 0.2 0.07
Atp2b1 P11505 S1216;S1230 Plasma membrane calcium-transporting ATPase 1 NSS*PPPSPN#KN#NNAVDS*GIHLTIEMNK 0.2 0.075
Odf2 Q6AYX5 S101;S104;T105 Outer dense fiber protein 2 LS*DLS*T*EDDDSGHC^K 0.2 0.075
Map2 P15146 S1541 Microtubule-associated protein 2 VTDGITKS*PEK 0.2 0.077
Tor1aip1 Q5PQX1 S231 Torsin-1A-interacting protein 1 SPRPDASIVQHINPFEEGETEDDLESSYS*DVTIR 0.2 0.078
Ehd1 Q641Z6 S456 EH domain-containing protein 1 DKPTYDEIFYTLS*PVN#GK 0.2 0.078
PAGR1 Q5M865 T175 PAXIP1-associated glutamate-rich protein 1 EEEEEKPHMPTEFDFDDEPVT*PK 0.2 0.081
Hdgf Q8VHK7 T200;S202 Hepatoma-derived growth factor N#ST*PS*EPDSGQ#GPPPEEEEGEEEAAKEEAEAQGVR 0.2 0.085
Kat7 Q810T5 S101;S103;S112 Histone acetyltransferase KAT7 SS*GS*ETEQAVDFS*DRETK 0.2 0.086
Gab2 Q9EQH1 S620;S623;S626 GRB2-associated-binding protein 2 KPS*TSS*VTS*DEKVDYVQVDK 0.2 0.09
Rps3 P62909 T221 40S ribosomal protein S3 DEILPTT*PISEQ#K 0.2 0.094
Pde4a P54748 S140;S145;S147;S152 cAMP-specific 3',5'-cyclic phosphodiesterase 4A RES*FLYRS*DS*DYDMS*PK 0.2 0.097
Chd6 D3ZA12 S2676 Chromodomain-helicase-DNA-binding protein 6 EPGSDQNC^TESSVTVS*PEREHVAQAR 0.2 0.113
Wnk4 Q7TPK6 S759 Serine/threonine-protein kinase WNK4 DAGPSEATEDALS*PQ#EEPAAM@PALPGPSDAELQ#R 0.2 0.12
Akap12 Q5QD51 S614;S616 A-kinase anchor protein 12 RPS*ES*DKEEELEK 0.2 0.128
Myh10 Q9JLT0 S1965 Myosin-10 TS*DVN#ETQPPQSE 0.2 0.144
Inpp5j Q9JMC1 S907;S909 Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A GGSRS*PS*PQSR 0.2 0.153
Lmna P48679 S406;S407 Prelamin-A/C ASSHS*S*QSQGGGSVTK 0.2 0.153
Hcn1 Q9JKB0 T855 Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 ST*VPQR 0.2 0.169
Ncbp1 Q56A27 S681 Nuclear cap-binding protein subunit 1 SDDDDRGS*DRK 0.2 0.171
Dbnl Q9JHL4 S277 Drebrin-like protein AMS*TTSVSSSQPGK 0.19 5.73E-04
Prkar2b P12369 S218 cAMP-dependent protein kinase type II-beta regulatory subunit GS*FGELALMYNTPR 0.19 7.68E-04
Mpdz O55164 T1593 Multiple PDZ domain protein SST*PAIFASDPATC^PIIPGC^ETTIEISK 0.19 0.002
Cdc42ep1 A1A5P0 S139 Cdc42 effector protein 1 LS*FDSTPASSTDGR 0.19 0.002
Hnrnpc G3V9R8 S231 Heterogeneous nuclear ribonucleoprotein C SEEEQS*S?ASVKKDETNVK 0.19 0.004
Ubxn2b P0C627 S66 UBX domain-containing protein 2B LYS*GDQEYGGLHIAQPPTGK 0.19 0.004
Myo9b Q63358 S1398 Unconventional myosin-IXb DKKPS*LEGVEETEGSGGQAAQEAPAR 0.19 0.004
Kalrn P97924 S1869 Kalirin GS*LKDPTVC^LN#EGM@APPTPPR 0.19 0.005
Map4 Q5M7W5 S535 Microtubule-associated protein 4 NADLHS*GTELTLDN#SMTPPSDPALPLETK 0.19 0.005
Pitpnm1 Q5U2N3 T287;S300 Membrane-associated phosphatidylinositol transfer protein 1 TAGT*PDGPEAPPGPDAS*PDASFGK 0.19 0.006
Pde4a P54748 S786 cAMP-specific 3',5'-cyclic phosphodiesterase 4A TLS*SSEEAPGLLGLPSTAAEVEAPR 0.19 0.009
Dctn2 Q6AYH5 S83 Dynactin subunit 2 TGYES*GDYEMLGEGLGVK 0.19 0.01
Tgfb1i1 Q99PD6 T188 Transforming growth factor beta-1-induced transcript 1 protein VQN#HLPASGPPQPPAVSPT*R 0.19 0.01
Rnf4 O88846 S98;S99 E3 ubiquitin-protein ligase RNF4 QDHADSC^VVS*S*DDEELSKDK 0.19 0.013
Notch2 Q9QW30 S1779 Neurogenic locus notch homolog protein 2 AEDDEALLS*EDDPVDR 0.19 0.016
Tmem79 Q3T1H8 S38;S43 Transmembrane protein 79 SPPQASVLQPEEEGGTES*PGAES*LR 0.19 0.017
Exoc7 O54922 S242 Exocyst complex component 7 SS*SSSGVPYSPAIPNK 0.19 0.018
Ctu2 Q3B7U4 S164 Cytoplasmic tRNA 2-thiolation protein 2 RAS*QEPAGTEEAYK 0.19 0.019
Arhgef7 O55043 S79 Rho guanine nucleotide exchange factor 7 S*PPKGFDTTAINK 0.19 0.019
Prdm2 Q63755 S416 PR domain zinc finger protein 2 RPS*MTLQSSEDPDDGKGENVTSK 0.19 0.02
Rab11fip1 Q3B7T9 S349 Rab11 family-interacting protein 1 ESSPSNSPS*PQGFR 0.19 0.02
Gramd2b Q5FVG8 T288 GRAM domain-containing protein 3 RQDLEGYSSSGSQT*PESENSR 0.19 0.02
Gorasp2 Q9R064 S418 Golgi reassembly-stacking protein 2 ADTSSLTVDVM@S*PASK 0.19 0.021
Rtn4 Q9JK11 S111 Reticulon-4 S*PAAPAPSLPPAAAVLPSK 0.19 0.022
Sh2b1 Q62985 S126 SH2B adapter protein 1 S*SEDLAGPLPSSVSSSTTSSKPK 0.19 0.022
Ybx3 Q62764 S33;S52 Y-box-binding protein 3 S*PAASGAPQ#APAPAALLAGS*PGGDAAPGPAPASSAPAGSEDAEK 0.19 0.022
Ppip5k1 P0C644 S1034 Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 QSGLGSQC^TGLFSTTVLGGSSS*APNLQDYAR 0.19 0.024
Dnajc5 P60905 T167 DnaJ homolog subfamily C member 5 EAT*DTPIVIQPASATETTQLTADSHPSYHTDGFN 0.19 0.025
Tanc1 Q6F6B3 S1455;S1462 Protein TANC1 DHFPIEEAEEEDTS*SQEESIS*PTPR 0.19 0.025
Map2 P15146 S1818;S1820;S1821;S1824 Microtubule-associated protein 2 VDHGAEIITQS?PS*RS*S*VAS*PR 0.19 0.027
Prpf4b Q5RKH1 S427;S431;S437 Serine/threonine-protein kinase PRP4 homolog S*KDAS*PINRWS*PSR 0.19 0.029
Fam129b B4F7E8 S667;S668;S693 Niban-like protein 1 GLLAQDLQAES*S*PPASPLLNGAPVQ#ESPQPMTVLEAS*PPASPLR 0.19 0.031
Rab34 Q5U1Y1 S241 Ras-related protein Rab-34 INS*DDKNLYLTASK 0.19 0.032
Cdc42bpb Q7TT49 S1192 Serine/threonine-protein kinase MRCK beta TSS*LLILTENENEK 0.19 0.032
Arhgap27 Q6TLK4 S459;S469 Rho GTPase-activating protein 27 SS*QDSDTPAQAS*PPEEK 0.19 0.032
Nfia P09414 S280;S287 Nuclear factor 1 A-type LKS*VEDEM@DS*PGEEPFYTGQGR 0.19 0.033
Mapk1 P63086 T183;Y185 Mitogen-activated protein kinase 1 VADPDHDHTGFLT*EY*VATR 0.19 0.034
Pde4d P14270 S710 cAMP-specific 3',5'-cyclic phosphodiesterase 4D EWYQSTIPQS*PSPAPDDQEDGR 0.19 0.037
Pak2 Q64303 T169 Serine/threonine-protein kinase PAK 2 GSETSAVVT*EEDDDDEDAAPPVIAPRPDHTK 0.19 0.039
Plec P30427 S4621;S4625 Plectin GYYSPYSVS*GSGS*TAGSR 0.19 0.041
Thoc5 Q68FX7 S28 THO complex subunit 5 homolog N#RS*DTEQEGR 0.19 0.045
Slc12a9 Q66HR0 T196 Solute carrier family 12 member 9 A$SFLT*FLLVSGSLAS?VLVSFVAVGPR 0.19 0.046
Dlc1 Q63744 S549 Rho GTPase-activating protein 7 DS*GVGASLTR 0.19 0.046
Fcho2 D3ZYR1 S507;S510 F-BAR domain only protein 2 AES*SSS*ISSSASLSAANTPTVGVSR 0.19 0.047
Rbm5 B2GV05 S69;S72;S78 RNA-binding protein 5 NS*DRS*EDGYHS*DGDYGEHDYR 0.19 0.049
Stk39 O88506 S394;S402 STE20/SPS1-related proline-alanine-rich protein kinase TEDGDWEWS*DDEMDEKS*EEGK 0.19 0.05
Slc14a2 Q62668 T524 Urea transporter 2 KPT*VELLDLNTMEESSEIK 0.19 0.051
Abcc3 O88563 S902 Canalicular multispecific organic anion transporter 2 EMS*SLS?SEGEGQNRPVLK 0.19 0.053
Plekhf1 Q68FU1 S242;S243;S249 Pleckstrin homology domain-containing family F member 1 GSPGQLTHLGSTMC^GAS*S*GDDDDS*DEDR 0.19 0.053
Plin5 M0R7Z9 S230 Perilipin-5 LGS*LSAR 0.19 0.055
Hp1bp3 Q6P747 S429 Heterochromatin protein 1-binding protein 3 KVSDGS*EDEDEEEDEEES?S?EDSEDEEPPPK 0.19 0.058
Sqstm1 O08623 S341 Sequestosome-1 IALESVGQPEELMESDN#C^SGGDDDWTHLS*SK 0.19 0.058
Phyhipl Q6AYN4 S11;S12 Phytanoyl-CoA hydroxylase-interacting protein-like LDHALS*S*PSSPC^EEIK 0.19 0.058
Cdk17 O35831 S146 Cyclin-dependent kinase 17 LS*LPADIR 0.19 0.059
Cds2 Q91XU8 S20;S22 Phosphatidate cytidylyltransferase 2 EDAPPEDKES*ES*EAKLDGETASDSESR 0.19 0.059
Pip4k2b O88377 S17 Phosphatidylinositol 5-phosphate 4-kinase type-2 beta S$SNC^TSTTAVAVAPLS*ASK 0.19 0.059
Mprip Q9ERE6 S381 Myosin phosphatase Rho-interacting protein S*TESSMTPDLLNFK 0.19 0.062
Thrap3 Q5M7V8 S935;T937 Thyroid hormone receptor-associated protein 3 FSGEEGEIEDDES*GT*ENREEK 0.19 0.066
Ilf3 Q9JIL3 T67 Interleukin enhancer-binding factor 3 GNSELSEAEN#M@DT*PPDDESK 0.19 0.069
Plec P30427 S4616;S4625;S4629 Plectin GYYS*PYSVSGSGS*TAGS*R 0.19 0.069
Rnf13 Q66HG0 S292;S294;T296 E3 ubiquitin-protein ligase RNF13 VVPSQGDS*DS*DT*DSSQ#EENQVSEHTPLLPPSASAR 0.19 0.071
Hmga1 Q8K585 S36 Zinc finger Ran-binding domain-containing protein 2 KQPSVS*PGTALVGSQK 0.19 0.071
Arhgef28 P0C6P5 S1535 Rho guanine nucleotide exchange factor 28 S*LPAVFSPGSK 0.19 0.071
Golga4 Q5U4E6 S37;S41 Golgin subfamily A member 4 S*RTSS*FTDQLDDATPNR 0.19 0.072
Nup93 Q66HC5 S52 Nuclear pore complex protein Nup93 TS*QETADVK 0.19 0.072
Plec P30427 S2042 Plectin AS*ESELER 0.19 0.072
Uba5 Q5M7A4 S380 Ubiquitin-like modifier-activating enzyme 5 EDS*VSEVTVEDSGESLEDLMAR 0.19 0.073
Nr2c1 Q8VIJ4 S203 Nuclear receptor subfamily 2 group C member 1 S*PLAATPTFVTDSETAR 0.19 0.075
Slc4a4 Q9JI66 S1026;S1029;S1034 Electrogenic sodium bicarbonate cotransporter 1 KGS*LDS*DNDDS*DC^PYSEK 0.19 0.079
Ldha P04642 S80 L-lactate dehydrogenase A chain IVSS*KDYSVTANSK 0.19 0.081
Lnpep P97629 S51 Leucyl-cystinyl aminopeptidase EPC^LHPLEPDEVEYEPRGS*R 0.19 0.082
Phf10 Q4V7A6 S17;S26 PHD finger protein 10 RC^DS*DPASPGAQS*PKDDNEDNSNDGGHPSK 0.19 0.084
Srgap2 D4A208 S427 SLIT-ROBO Rho GTPase-activating protein 2 STVS*ETFMSKPSIAK 0.19 0.086
Srsf2 Q6PDU1 S206;S208 Serine/arginine-rich splicing factor 2 S*KS*PPKS?PEEEGAVS?S 0.19 0.1
Map4 Q5M7W5 T506;S522 Microtubule-associated protein 4 VTEFN#N#VT*PLSEEEVASIKDVSPS*PETETAK 0.19 0.103
Mavs Q66HG9 S172 Mitochondrial antiviral-signaling protein MS*GDSLISSPNPPALSPQPSR 0.19 0.109
Dtnb P84060 T522 Dystrobrevin beta AQAT*GSPHTSPTHGGGR 0.19 0.114
Gtf2f1 Q6AY96 S305;S307;S308;S311 General transcription factor IIF subunit 1 GVDEQS*ES*S*EES*EEEKPPEEDKEEEEEK 0.19 0.119
Srsf5 Q09167 S245;S247;S250 Serine/arginine-rich splicing factor 5 S*KS*PAS*VDR 0.19 0.128
Cry2 Q923I8 T580;S591 Cryptochrome-2 RARVT*VTQM@PAQEPPS*K 0.19 0.129
Anp32b Q9EST6 T265 Acidic leucine-rich nuclear phosphoprotein 32 family member B ET*DDEGEDD 0.19 0.13
Epn3 Q4V882 S224 Epsin-3 S*WKGDDFPVAN#GAEPAGQR 0.19 0.133
Dab2ip Q6P730 S838 Disabled homolog 2-interacting protein S*KEELSQAEK 0.19 0.137
Hsp90aa1 P82995 S252;S263 Heat shock protein HSP 90-alpha EEKES*DDKPEIEDVGS*DEEEEEK 0.19 0.154
Nucks1 Q9EPJ0 S61 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 NSQEDSEDS*EEK 0.19 0.157
Sptbn2 Q9QWN8 S1255 Spectrin beta chain, non-erythrocytic 2 ADS*IEKR 0.19 0.16
Nr3c1 P06536 S193 Glucocorticoid receptor S*QTGTN#GGSVK 0.19 0.165
Ccdc8 P62521 S449 Coiled-coil domain-containing protein 8 TEATAS*PR 0.19 0.193
Arhgef28 P0C6P5 S1200 Rho guanine nucleotide exchange factor 28 TSES*DEER 0.19 0.209
Mark3 Q8VHF0 S436 MAP/microtubule affinity-regulating kinase 3 RS*QTSTADSDLKEDGVPSR 0.18 1.56E-04
Sfswap D3ZTQ1 S518 Splicing factor, suppressor of white-apricot homolog EGGGSTQ#AAS*TAEEAPTETAVEESSEAGEDGAPEGMAETGGR 0.18 0.003
Csde1 P18395 S116 Cold shock domain-containing protein E1 S*PAAPGQSPTGSVC^YER 0.18 0.004
Crtc2 Q3LRZ1 S489;T501 CREB-regulated transcription coactivator 2 LPPYPYS*PPSLVIPSHPPT*PK 0.18 0.005
Pex19 Q9QYU1 S117 Peroxisomal biogenesis factor 19 VGS*DASSQQEFTSC^LK 0.18 0.006
Rbm34 Q5M9F1 S19 RNA-binding protein 34 RQS*SEDDVGNAATDYLVGQVADSLR 0.18 0.006
Tgs1 P85107 S431 Trimethylguanosine synthase SHELDIDEN#PDS*EVDDN#GFHLGFK 0.18 0.007
Atp7a P70705 S346;S353;T355 Copper-transporting ATPase 1 VS*ISSEVES*PT*SSPSSSSLQK 0.18 0.008
Bcar1 Q63767 Y508 Breast cancer anti-estrogen resistance protein 1 VLPPEVADGSVIDDGVY*AVPPPAER 0.18 0.011
Slc38a10 E9PT23 S441 Putative sodium-coupled neutral amino acid transporter 10 LSVQDPVVVM@AEDS*QEK 0.18 0.012
Prune1 Q6AYG3 T411;S415 Exopolyphosphatase PRUNE1 ASNSLIAGLSQDDEDPPLPPT*PM@NS*LVDEC^PLDQGLPK 0.18 0.013
Shroom2 Q7TP36 S1069 Protein Shroom2 ARPPEPQPPSTPAPPVRDS*C^S?SPPSLNYGK 0.18 0.013
Sorbs2 O35413 S354 Sorbin and SH3 domain-containing protein 2 KS*EPAVGPPR 0.18 0.013
Tmc5 Q5M7W4 S248 Transmembrane channel-like protein 5 GS*FGILGR 0.18 0.014
Pcnp Q7TP40 S130 PEST proteolytic signal-containing nuclear protein TLSVAAAFN#EDEDS*EPEEM@PPEAK 0.18 0.015
Rbmx2 B0BN49 T140 RNA-binding motif protein, X-linked 2 T*PPS?S?PPEVSEDEDAK 0.18 0.015
Mprip Q9ERE6 S294;S297;T300 Myosin phosphatase Rho-interacting protein AEEQLPPLLS*PPS*PST*PHSR 0.18 0.016
Slc38a10 E9PT23 S826 Putative sodium-coupled neutral amino acid transporter 10 DLADLPAGGSDTEPHGASS*K 0.18 0.018
Palm Q920Q0 T335 Paralemmin-1 AELVVIEDSVT*PR 0.18 0.018
Magi3 Q9JK71 S1232 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 SVNRHS*EEHLEK 0.18 0.018
Gtf2i Q5U2Y1 S703 General transcription factor II-I EFS*FEAWNAK 0.18 0.018
Nf2 Q63648 S514 Merlin (Fragment) LS*MEIEK 0.18 0.02
Wnk4 Q7TPK6 S1033 Serine/threonine-protein kinase WNK4 LPTPQLTSESS*DTEDSAAGGPETR 0.18 0.021
Fxr1 Q5XI81 T540 Fragile X mental retardation syndrome-related protein 1 RRT*DEDAVLMDGMTESDTASVNEN#GLGK 0.18 0.023
Arfip1 Q9JHU5 T354 Arfaptin-1 LKT*PGVDAPSWLEEQ 0.18 0.023
Map2 P15146 S1816;S1818;S1821;S1824 Microtubule-associated protein 2 VDHGAEIITQS*PS*RSS*VAS*PR 0.18 0.024
Mef2d O89038 S98;S110 Myocyte-specific enhancer factor 2D KGFN#GC^DS*PEPDGEDSLEQS*PLLEDK 0.18 0.026
Prom2 Q8CJ52 S815 Prominin-2 LSS*TS?SEETQLFHIPR 0.18 0.027
PAGR1 Q5M865 S91 PAXIP1-associated glutamate-rich protein 1 AEGESEDWC^VPC^S*DEEVELPAN#GQ#SWMPPPSEIQR 0.18 0.027
Krt8 Q10758 S43 Keratin, type II cytoskeletal 8 VGS*SS?SSFR 0.18 0.028
Chd6 D3ZA12 S2125 Chromodomain-helicase-DNA-binding protein 6 SS*LSEPEATEHSFSN#GAALAAQIQK 0.18 0.028
Otud5 Q2YDU3 S165;S177 OTU domain-containing protein 5 QAPGVGAVGGAS*PEREEVGAGYNS*EDEYEAAAAR 0.18 0.028
Crtc2 Q3LRZ1 S622 CREB-regulated transcription coactivator 2 HGSGPNIILTGDSS*PGFSK 0.18 0.028
Map1b P15205 S1314;T1326 Microtubule-associated protein 1B TLEVVS*PSQSVTGSAGHT*PYYQSPTDEK 0.18 0.03
Scap A2RRU4 S837;S843 Sterol regulatory element-binding protein cleavage-activating protein LS*DGGKAS*PEEPGDSPPLR 0.18 0.031
Oxr1 Q4V8B0 S488 Oxidation resistance protein 1 DS*ETEVEELR 0.18 0.031
Ndrg1 Q6JE36 T328;S330 Protein NDRG1 T*AS*GSSVTSLEGTR 0.18 0.031
Tsc1 Q9Z136 S1097 Hamartin NKS*ESQC^DEDGMTMSSFSETLK 0.18 0.032
Ank3 O70511 S921;S924 Ankyrin-3 SAS*LRS*FS?S?DRSYTLNR 0.18 0.035
Cavin3 Q9Z1H9 S199 Caveolae-associated protein 3 KGS*EAAQPTPVKPPR 0.18 0.035
Itpr2 P29995 S1160;T1168 Inositol 1,4,5-trisphosphate receptor type 2 GGEEANEESNLLS*PVQDGAKT*PQIDSNK 0.18 0.036
Afdn O35889 S1179;S1189 Afadin S*SPNVANQPPS*PGGK 0.18 0.038
Pgd P85968 S37 6-phosphogluconate dehydrogenase, decarboxylating TVS*KVDDFLAK 0.18 0.039
Arfgap3 Q4KLN7 S460 ADP-ribosylation factor GTPase-activating protein 3 LS*TSSSISSADLFDEQR 0.18 0.039
Slc9a1 P26431 S776;S790;S793 Sodium/hydrogen exchanger 1 SKEPSS*PGTDDVFTPGPSDS*PGS*QR 0.18 0.039
Bcar1 Q63767 Y347 Breast cancer anti-estrogen resistance protein 1 HLLAPGSQDIY*DVPPVR 0.18 0.039
Snn P61808 S49 Stannin ISQSEDEES*IVGDGETK 0.18 0.04
Chordc1 D4A4T9 S200 Cysteine and histidine-rich domain-containing protein 1 TS*DFNTFLAQEGC^TR 0.18 0.041
Plce1 Q99P84 S1118 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 SGS*DPQEANEQ#EDSEANVITNPPNPLHSR 0.18 0.042
Pitpnm1 Q5U2N3 S1235 Membrane-associated phosphatidylinositol transfer protein 1 SIS*LKLDSEE 0.18 0.042
Epn3 Q4V882 T466 Epsin-3 EARPC^RT*PESFLGPSASSLVNLDSLVK 0.18 0.042
Abcc1 Q8CG09 S883 Multidrug resistance-associated protein 1 TYANTEQDLASEDDS*KN#GVSGLGK 0.18 0.042
Pkn2 O08874 T534;T539 Serine/threonine-protein kinase N2 AIPTVNHSGT*FSPQT*PVPATVPVVDAR 0.18 0.043
Eif3b Q4G061 S68;S75;S79 Eukaryotic translation initiation factor 3 subunit B AKPAAQS*EEETAAS*PAAS*PTPQSAQEPSAPGK 0.18 0.045
Slk O08815 S340 STE20-like serine/threonine-protein kinase RAS*SDLSIASSEEDK 0.18 0.046
Map1s P0C5W1 S458;S462;S465 Microtubule-associated protein 1S RPVVTTQDLEVPS*RANS*QDS*LASR 0.18 0.047
Tbx3 Q7TST9 S680 T-box transcription factor TBX3 SAVLAAS*PASVAVDSGSELNSR 0.18 0.047
Mark2 O08679 S30 Serine/threonine-protein kinase MARK2 DTEQPTLGHLDSKPSS*K 0.18 0.047
Abcc1 Q8CG09 S916;S930;S931 Multidrug resistance-associated protein 1 HLS*NSSSHSVVTNQQHS*S*TAELQK 0.18 0.048
Mettl6 Q6AXU8 S15 Methyltransferase-like protein 6 ILS*TGEEEK 0.18 0.049
Abcc5 Q9QYM0 S508;S509 Multidrug resistance-associated protein 5 N#ATLAWDSSHSSTQS*S*PK 0.18 0.05
Copg1 Q4AEF8 S12 Coatomer subunit gamma-1 KDEES*GGGSN#PLQHLEK 0.18 0.055
Mmtag2 Q5M9I6 S213;S216;S217;S219 Multiple myeloma tumor-associated protein 2 homolog READS*C^SS*S*PS*PARPR 0.18 0.056
Magi3 Q9JK71 S679 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 ETSGS*LETINEPTPQPM@PFPPSIIR 0.18 0.058
Map1b P15205 T568 Microtubule-associated protein 1B KESKEEAPEAT*K 0.18 0.058
Vcpip1 Q8CF97 S45 Deubiquitinating protein VCIP135 ILS*GSC^PDPK 0.18 0.059
Cds2 Q91XU8 S20;S22;S32 Phosphatidate cytidylyltransferase 2 EDAPPEDKES*ES*EAKLDGETAS*DSESR 0.18 0.06
Yap1 Q2EJA0 S385 Transcriptional coactivator YAP1 TPDDFLN#S*VDEM@DTGDTISQSTLPSQQSR 0.18 0.061
Rpap1 Q3T1I9 S175 RNA polymerase II-associated protein 1 APSAEQVVPS*PDAPEGAVPC^ETPSSK 0.18 0.061
Hdgf Q8VHK7 T200 Hepatoma-derived growth factor N#S?T*PSEPDSGQGPPPEEEEGEEEAAKEEAEAQGVR 0.18 0.062
Prkd1 Q9WTQ1 S241 Serine/threonine-protein kinase D1 S*PSESFIGR 0.18 0.069
Mprip Q9ERE6 S230;T241 Myosin phosphatase Rho-interacting protein AKDQPDGTSLS?PVQS*PSQSQPPAAC^T*PR 0.18 0.069
Hp1bp3 Q6P747 S70;S74;S76 Heterochromatin protein 1-binding protein 3 LAEGEEEKPEPDGS*SEES*IS*TVEEPEN#ETPPAPSR 0.18 0.07
Kctd1 Q8R4G8 S9;S12 BTB/POZ domain-containing protein KCTD1 S*PAS*PLNNQGIPTPAQLTK 0.18 0.071
Rrad P55043 S84 GTP-binding protein RAD LDWPEGSSDSLS?S?GDS*GSEDGVYK 0.18 0.071
Msantd4 Q501L3 S152 Myb/SANT-like DNA-binding domain-containing protein 4 VEEEERDPQS*PEFEIEEEEEMLSSVIPDSR 0.18 0.081
Tle3 Q9JIT3 S240;S245;T259 Transducin-like enhancer protein 3 YDS*DGDKS*DDLVVDVSNEDPAT*PR 0.18 0.091
Arhgap35 P81128 S1070 Rho GTPase-activating protein 35 S*MSSSPWMPQDGFDPSDYAEPMDAVVKPR 0.18 0.093
Tsc22d4 Q3B8N7 T183 TSC22 domain family protein 4 VET*PPLSASPPQ#QRPPGPGTGDSAQTLPSLR 0.18 0.098
Rbm5 B2GV05 S69;S72;Y82 RNA-binding protein 5 NS*DRS*EDGYHSDGDY*GEHDYR 0.18 0.101
Arhgef28 P0C6P5 S1198 Rho guanine nucleotide exchange factor 28 TS*ESDEER 0.18 0.103
Sptbn2 Q9QWN8 S2382 Spectrin beta chain, non-erythrocytic 2 RFS*FFK 0.18 0.106
Prpf4b Q5RKH1 S21;S24 Serine/threonine-protein kinase PRP4 homolog EQPEMDDADNS*EKS*VNEEN#GEVSEDQSQNK 0.18 0.106
Washc2 Q80X08 S384;S387 WASH complex subunit 2 GQPAQ#GPVSEES*PPS*PKPGK 0.18 0.107
Foxo1 G3V7R4 S313 Forkhead box protein O1 TSS*NASTISGR 0.18 0.122
Nfkbib Q9JIA3 S346 NF-kappa-B inhibitor beta SQNQPPPS*PAAKPLPDDPNPA 0.18 0.124
Mical2 D4A1F2 S507;S509;S511 [F-actin]-methionine sulfoxide oxidase MICAL2 RS*AS*LS*RR 0.18 0.131
Itpkb P42335 S603 Inositol-trisphosphate 3-kinase B LSSSSASSTGFSSSYEDS*EEDISSDPER 0.18 0.139
Kat6a Q5TKR9 S1104;S1114 Histone acetyltransferase KAT6A TAS*KDEEEEEEES*DDADDTPVLKPVSLLR 0.18 0.146
Dek Q6AXS3 S245;S246 Protein DEK DES*S*EDEEKESEEEQPPK 0.18 0.147
Map2k2 P36506 S23 Dual specificity mitogen-activated protein kinase kinase 2 KPVLPALTIN#PTIAEGPS*PTSEGASEAHLVDLQK 0.18 0.147
Calcoco1 Q66HR5 S593;S594;S595;S597 Calcium-binding and coiled-coil domain-containing protein 1 ESSSLVVINQPAPIAPQ#LSGPGEAS*S*S*DS*EAEDEK 0.18 0.15
Nes P21263 S1889;S1890 Nestin FTLSGVDGDSWS*S*GED 0.18 0.152
Hdgfl2 Q925G1 T609 Hepatoma-derived growth factor-related protein 2 SAPVN#GEAASQKGENT*EDGAQEDGQDLEDGPR 0.18 0.155
Nucks1 Q9EPJ0 T202;S204 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 EKT*PS*PK 0.18 0.158
Gprc5c Q3KRC4 T422 G-protein coupled receptor family C group 5 member C AEDM@YMVQSHQVAT*PTK 0.18 0.169
Nucks1 Q9EPJ0 S73;S75;S79 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 DDS*HS*AEDS*EDEKDDHK 0.18 0.179
Nono Q5FVM4 S165;S174 Non-POU domain-containing octamer-binding protein FAC^HSASLTVRNLPQ#YVS*NELLEEAFS*VFGQ#VER 0.18 0.188
Arpc5l A1L108 S64 Actin-related protein 2/3 complex subunit 5-like protein NS*PINTK 0.18 0.194
Hdgfl3 Q923W4 S179 Hepatoma-derived growth factor-related protein 3 SSS*EGGDAGN#DTR 0.18 0.207
Arglu1 Q5BJT0 S75 Arginine and glutamate-rich protein 1 ASS*PPDR 0.18 0.21
Sept9 Q9QZR6 T150 Septin-9 RVET*PASK 0.18 0.213
Nucks1 Q9EPJ0 S54;S58 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 SGKNS*QEDS*EDSEEK 0.18 0.217
Slmap P0C219 S476 Sarcolemmal membrane-associated protein ESDLSDTLS*PSKEK 0.17 6.17E-04
Epb41l1 Q9WTP0 S666 Band 4.1-like protein 1 GPSS*QEDESGGIEDSPDR 0.17 0.001
Bsnd Q8R2H3 S90 Barttin ALSLLETGLSEVKS*PQPPYVR 0.17 0.002
Hspa4 O88600 S506 Heat shock 70 kDa protein 4 SEES*EEPMETDQNAKEEEK 0.17 0.002
Phldb1 Q63312 S33 Pleckstrin homology-like domain family B member 1 (Fragment) LS*PAYSLGSLTGASPR 0.17 0.003
Stk10 E9PTG8 T951 Serine/threonine-protein kinase 10 LSEEAETRPTT*PNR 0.17 0.003
Pitpnm1 Q5U2N3 S593;S600 Membrane-associated phosphatidylinositol transfer protein 1 RGS*M@NNEMLS*PEVGPVRDPLADGVEVLGR 0.17 0.004
Slc9a1 P26431 T754;T755 Sodium/hydrogen exchanger 1 GPRT*T*PEEEEEDEDGVIMIR 0.17 0.004
Phlpp1 Q9WTR8 S303 PH domain leucine-rich repeat protein phosphatase 1 VN#PAPSDSSPGELFAGGPC^S*PSR 0.17 0.006
Ralgapa2 P86411 S1592 Ral GTPase-activating protein subunit alpha-2 VTSQGQPS*PVEPR 0.17 0.009
Syt17 Q62807 T83 Synaptotagmin-17 SNDKDGDSVHTASDVPLT*PR 0.17 0.01
Szrd1 Q5XIA2 S105;S107 SUZ domain-containing protein 1 ILGS*AS*PEEEQEKPILDRPTR 0.17 0.01
Thoc6 Q6AY87 S180 THO complex subunit 6 homolog ERS*PEVLSGGEDGAVR 0.17 0.012
Pitpnm1 Q5U2N3 S342;S345;S346 Membrane-associated phosphatidylinositol transfer protein 1 DS*ENS*S*EEEFFDAHEGFS?DSDEVFPK 0.17 0.012
Atp1a1 P06685 S179 Sodium/potassium-transporting ATPase subunit alpha-1 M@S*INAEDVVVGDLVEVK 0.17 0.013
Taf6 Q63801 S666;S672 Transcription initiation factor TFIID subunit 6 AN#GS*QPTGPS*SPQPAL 0.17 0.013
Rtn1 Q64548 S68;T75 Reticulon-1 S*PPVAMET*ASTGVAAVPDALDHSSSPTLK 0.17 0.013
Macf1 D3ZHV2 S2769 Microtubule-actin cross-linking factor 1 LQS*QLQENEEFQK 0.17 0.017
Ubr5 Q62671 S2475 E3 ubiquitin-protein ligase UBR5 S*VVDM@DLDDTDDGDDNAPLFYQPGK 0.17 0.017
Tmem79 Q3T1H8 S162 Transmembrane protein 79 LS*HPEPPER 0.17 0.018
Zdhhc5 Q2THW7 S380 Palmitoyltransferase ZDHHC5 GDS*LKEPTSIADSSR 0.17 0.021
Lzts2 Q3LUD4 S224;S242 Leucine zipper putative tumor suppressor 2 NS*LSSLPTYSTGGAEPTANS*PGGHLPSHGPGR 0.17 0.021
Ralgapa1 O55007 S859;S860 Ral GTPase-activating protein subunit alpha-1 RGS*S*PGSLEIPK 0.17 0.022
Pex14 Q642G4 S334 Peroxisomal membrane protein PEX14 EDEEGEEDEDDDVS*HVDEEDVLGVQ#R 0.17 0.023
Cadps Q62717 S89 Calcium-dependent secretion activator 1 AGGGRPSS*PSPSVVSEK 0.17 0.023
Ccdc8 P62521 S217 Coiled-coil domain-containing protein 8 SGS*EVGQAQQSSIAER 0.17 0.024
Eif3g Q5RK09 S42 Eukaryotic translation initiation factor 3 subunit G GIPLPTGDTS*PEPELLPGDPLPPPK 0.17 0.025
Snx24 Q5U2S5 S116 Sorting nexin-24 AESC^GS*FDETESEESSK 0.17 0.025
Itpr1 P29994 S1942 Inositol 1,4,5-trisphosphate receptor type 1 EADPDDHYQS*GEGTQATTDK 0.17 0.025
Bad O35147 S113;S129 Bcl2-associated agonist of cell death HSS*YPAGTEEDEGM@EEELS*PFR 0.17 0.027
Krt19 Q63279 S67 Keratin, type I cytoskeletal 19 GGS*FSGALTVTDGLLGGN#EK 0.17 0.027
Unc5d F1LW30 T424;T429 Netrin receptor UNC5D RSHSDYGVDVIDSSALT*GGFQ#T*FN#FKTVR 0.17 0.028
Ctnnb1 Q9WU82 S675 Catenin beta-1 LS*VELTSSLFR 0.17 0.029
Map4 Q5M7W5 S515;S522 Microtubule-associated protein 4 VTEFN#NVTPLSEEEVAS*IKDVSPS*PETETAK 0.17 0.03
Pllp P47987 S24 Plasmolipin TSSPAQGVGASVS*AM@RPDLGFVR 0.17 0.032
Clasp2 Q99JD4 S20 CLIP-associating protein 2 SFDDEES*VDGNRPSSAASAFK 0.17 0.032
Ralgapa2 P86411 S376;S379 Ral GTPase-activating protein subunit alpha-2 LSNSS*LC^S*IEEEHR 0.17 0.032
Sh2d4a Q6AYC8 S285 SH2 domain-containing protein 4A TKTS*STQEDIIR 0.17 0.034
Cgref1 P97586 S273 Cell growth regulator with EF hand domain protein 1 DLPAETLETQNTPN#VVEAHS*IQLENDEI 0.17 0.034
Akap12 Q5QD51 T266;S273;S274 A-kinase anchor protein 12 QEKEPT*KSPESPS*S*PVSSETTSSFK 0.17 0.035
Slk O08815 T386 STE20-like serine/threonine-protein kinase VLSEKPT*PEGPEK 0.17 0.036
Rpl30 P62890 S10 60S ribosomal protein L30 KS*LESINSR 0.17 0.037
Palm Q920Q0 S244;S248 Paralemmin-1 ADEVTLS*EAGS*TTGPAEPR 0.17 0.037
Tcea1 Q4KLL0 S81 Transcription elongation factor A protein 1 LLDGPS*TDKDSEEK 0.17 0.037
Map2 P15146 T1598;T1600 Microtubule-associated protein 2 SGTST*PT*TPGSTAITPGTPPSYSSR 0.17 0.038
Exoc4 Q62824 T238 Exocyst complex component 4 DASPGPLIDVSNIST*PRK 0.17 0.039
Sarg Q499V8 S79 Specifically androgen-regulated gene protein TIGSLEAEADSGLSTDESEPATS*PQ#SFR 0.17 0.039
Tmem55a Q4V888 S14 Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase SPLLS*ASHSGNVTPTAPPYLQESSPR 0.17 0.04
Apc P70478 S2461;S2473 Adenomatous polyposis coli protein LEESAS*FESLSPSSRPDS*PTR 0.17 0.04
Pdcd4 Q9JID1 S87;S94 Programmed cell death protein 4 S*GVAVPTS*PK 0.17 0.041
L3mbtl2 Q3MIF2 S681;S685;S687 Lethal(3)malignant brain tumor-like protein 2 EEHQDLPS*PDRS*PS*PLLPLPTESIK 0.17 0.042
Akap12 Q5QD51 T266;S271 A-kinase anchor protein 12 QEKEPT*KSPES*PS?SPVSSETTSSFK 0.17 0.042
Rapgef2 F1M386 S1324 Rap guanine nucleotide exchange factor 2 AS*WASSTGYWGEDSEGDTGTIK 0.17 0.044
Kcnj2 Q64273 S10;S13 Inward rectifier potassium channel 2 TNRYS*IVS*SEEDGMK 0.17 0.045
Abi1 Q9QZM5 S247 Abl interactor 1 ENS*GSSSIGIPIAVPTPSPPTAGPAAPGAAPGSQYGTM@TR 0.17 0.045
Afdn O35889 S561;T566 Afadin LDSDRVS*SASST*AER 0.17 0.047
Mff Q4KM98 S131 Mitochondrial fission factor SMS*ENAVR 0.17 0.047
Hp1bp3 Q6P747 S429;S441;S442;S445 Heterochromatin protein 1-binding protein 3 KVSDGS*EDEDEEEDEEES*S*EDS*EDEEPPPK 0.17 0.047
Mpdz O55164 S1802;S1804;S1810;S1811 Multiple PDZ domain protein RPS*QS*SQVSES*S*LSSFSLPR 0.17 0.048
Sart1 Q5XIW8 S597;S602;S604 U4/U6.U5 tri-snRNP-associated protein 1 S*AN#GGS*ES*DGEENIGWSTVNLDEEK 0.17 0.051
Fcho2 D3ZYR1 S495 F-BAR domain only protein 2 LSGINEIPRPFSPPITSNTS*PPPTAPLAR 0.17 0.055
Casp8 Q9JHX4 S188 Caspase-8 RMS*TEGGEELPVSVLDEVTIK 0.17 0.055
Lhx1 P63007 S162 LIM/homeobox protein Lhx1 DSESANVS*DKEGGSNENDDQNLGAK 0.17 0.056
Add1 Q63028 S481 Alpha-adducin TS*TSAVPNLFVPLNTNPK 0.17 0.058
Epb41l1 Q9WTP0 S437;S441;S443 Band 4.1-like protein 1 SLDGAEFS*RPAS*VS*ENHDAGPDGDKR 0.17 0.06
Camk2d P15791 S504 Calcium/calmodulin-dependent protein kinase type II subunit delta S*GSPTVPIKPPC^IPN#GK 0.17 0.063
Ubr4 Q2TL32 S2718;S2722;T2724 E3 ubiquitin-protein ligase UBR4 HVTLPS*SPRS*NT*PMGDKDDDDDDDADEK 0.17 0.063
Ccnl2 Q5I0H5 S337 Cyclin-L2 GLLPPGSAPGLDSATAGFSPAPKPES*PK 0.17 0.063
Lrrfip1 Q66HF9 S663 Leucine-rich repeat flightless-interacting protein 1 Q#NDAEEDSGPAEGPTDVLDQ#N#SLQC^ADGDIS*PVGR 0.17 0.066
Marcks P30009 S128 Myristoylated alanine-rich C-kinase substrate EAAEAEPAEPGSPSAETEGASASSTSS*PK 0.17 0.067
Adam17 Q9Z1K9 S773 Disintegrin and metalloproteinase domain-containing protein 17 MDTIQEDPS?TDS*HVDDDGFEKDPFPN#SSAAAK 0.17 0.07
Arid4b Q9JKB5 S703;T706 AT-rich interactive domain-containing protein 4B DVEAIS*EDT*DFEEEDEITK 0.17 0.073
Map2 P15146 S1829;S1842 Microtubule-associated protein 2 RLS*NVS?S?SGSINLLES*PQLATLAEDVTAALAK 0.17 0.078
Zdhhc5 Q2THW7 S455 Palmitoyltransferase ZDHHC5 SEGTTSTS*YK 0.17 0.081
Fip1l1 Q5U317 S61 Pre-mRNA 3'-end-processing factor FIP1 DLDENEVERPEEEN#ASANPPS*GIEEEAAEN#GVAKPK 0.17 0.081
Ncoa2 Q9WUI9 S487 Nuclear receptor coactivator 2 M@NSPSQSSPGLNPGQPSSVLS*PR 0.17 0.082
Aak1 P0C1X8 S638 AP2-associated protein kinase 1 ILS*DVTHSAVFGVPASK 0.17 0.084
Mre11 Q9JIM0 S648 Double-strand break repair protein MRE11 N#YSETIEVDES*DDDDSFPTSSR 0.17 0.087
Rbmx2 B0BN49 T140;S143;S149 RNA-binding motif protein, X-linked 2 T*PPS*SPPEVS*EDEDAK 0.17 0.087
Eif3b Q4G061 S135;S137;S147 Eukaryotic translation initiation factor 3 subunit B ALEN#GEADEPS*FS*DPEDFVDDVS*EEELLGDVLK 0.17 0.088
Leo1 Q641X2 S190;T200 RNA polymerase-associated protein LEO1 LQNS*ADEEEKMQNT*DDEDR 0.17 0.089
Ciapin1 Q5XID1 S182 Anamorsin SS*SVKPVVDPATAK 0.17 0.092
Cldn15 D3ZQJ0 S211;S214;S217 Claudin-15 ATS*DES*DVS*FGK 0.17 0.094
Shank3 Q9JLU4 S1127;S1129;T1131;S1135 SH3 and multiple ankyrin repeat domains protein 3 ALASQTPS*RS*PT*PVHS*PDADRPGPLFVDVQTR 0.17 0.094
Limd1 B5DEH0 S367;S371 LIM domain-containing protein 1 LGC^VESGTS*PKPS*PTSNVHPVM@SAPSELSC^K 0.17 0.095
Epb41l1 Q9WTP0 S540;S541;S544;S546 Band 4.1-like protein 1 RLPS*S*PAS*PS*PK 0.17 0.096
Pard3 Q9Z340 S692;S695 Partitioning defective 3 homolog C^NELRS*PGS*PAAPELPIETELDDR 0.17 0.096
Pds5a A4L9P7 S1096 Sister chromatid cohesion protein PDS5 homolog A SALC^NADS*PKDPVLPMK 0.17 0.097
Myzap Q5EB94 S59 Myocardial zonula adherens protein DQPPELS*N#GESTK 0.17 0.098
Casc3 Q8K3X0 S145 Protein CASC3 GTVTGERQS*GDGQESTEPVENK 0.17 0.1
Prkce P09216 S337 Protein kinase C epsilon type LAAGAESPQPASGNS*PSEDDR 0.17 0.103
Itpkb P42335 S369 Inositol-trisphosphate 3-kinase B VHS*VGGQGSWTPEVIK 0.17 0.104
Pclo Q9JKS6 S1479 Protein piccolo RTS*IGSSSSDEYK 0.17 0.106
Ppp1r2 P50411 S89 Protein phosphatase inhibitor 2 IDEPDTPYHN#M@IGDDEDVC^SDS*EGN#EVMTPEILAK 0.17 0.106
Gorab B1H222 S311 RAB6-interacting golgin LS*QPDGEGVSSELTEENKEPQKPATSPETDK 0.17 0.106
Arhgef2 Q5FVC2 S955;S959 Rho guanine nucleotide exchange factor 2 LS*PPHS*PR 0.17 0.108
Avpr2 Q00788 S350 Vasopressin V2 receptor HTTHS*LGPQDESC^ATASSSLMK 0.17 0.109
Rbmx2 B0BN49 T140;S143;S144 RNA-binding motif protein, X-linked 2 T*PPS*S*PPEVSEDEDAK 0.17 0.11
Afap1l1 D4AB98 S93;S97;S103 Actin filament-associated protein 1-like 1 S*KEAS*PEPIKS*PSLR 0.17 0.11
Sp110 Q3KRF1 S243;S254 Sp110 nuclear body protein DDSGAQPPGS*PGTMHVVQDNS*PAPNDPEVPQEAPC^TPANK 0.17 0.115
Pkn1 Q63433 S346 Serine/threonine-protein kinase N1 NLPETIPWS*PPPSVGASGTPDSR 0.17 0.117
Hmga1 Q8K585 S99;S102;S103 Zinc finger Ran-binding domain-containing protein 2 KLEKEEEEGIS*Q#ES*S*EEEQ 0.17 0.121
Ppp2r5b Q80W83 S13 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform LPPAS?T?PT?S*PSSPGLSPVPPPDKVDGFSR 0.17 0.124
Ttgn1 P19814 S234;T243 Trans-Golgi network integral membrane protein TGN38 GDKS*SEPTEDVET*KEIEEGDTEPEEGSPLEEEN#EK 0.17 0.129
Afdn O35889 S1282 Afadin S*QEELR 0.17 0.13
Washc2 Q80X08 S1059 WASH complex subunit 2 GPVTQLSS*SPVLPN#GHQ#PLLQPR 0.17 0.132
Nucks1 Q9EPJ0 S75;S79 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 DDSHS*AEDS*EDEKDDHK 0.17 0.142
Camk2d P15791 T371 Calcium/calmodulin-dependent protein kinase type II subunit delta ESTESSNTT*IEDEDVK 0.17 0.145
Calr P18418 S231 Calreticulin IDDPTDS*KPEDWDKPEHIPDPDAK 0.17 0.162
Smarcad1 D3Z9Z9 T54;T63 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 ANT*PDSDVTEKT*EDSSVPEPPDNESK 0.17 0.162
Fam129b B4F7E8 S668;S683;S697 Niban-like protein 1 GLLAQDLQAESS*PPASPLLNGAPVQ#ES*PQ#PM@TVLEASPPAS*PLR 0.17 0.163
Nolc1 P41777 S567 Nucleolar and coiled-body phosphoprotein 1 AGKES*EEEEEDTEQNK 0.17 0.166
Crebbp Q6JHU9 S2345;S2351 CREB-binding protein S*PAPVQS*PRPQSQPPHSSPS?PR 0.17 0.181
Phax Q63068 T340;S341;T344;S347 Phosphorylated adapter RNA export protein SLNFQEDDDT*S*RET*FAS*DTNEALASLDEAQEGPGETK 0.17 0.187
Hdgf Q8VHK7 S132;S133 Hepatoma-derived growth factor GN#AEGS*S*DEEGK 0.17 0.194
Eif2ak3 Q9Z1Z1 S547 Eukaryotic translation initiation factor 2-alpha kinase 3 KES*ETQC^QTESK 0.17 0.214
Erc1 Q811U3 S37 ELKS/Rab6-interacting/CAST family member 1 TN#S*TGGSSGNSVGGGSGK 0.17 0.218
Arfgef2 Q7TSU1 S218;S227 Brefeldin A-inhibited guanine nucleotide-exchange protein 2 ELEKPIQSKPQ#S*PVIQATAGS*PK 0.17 0.227
Grm7 P35400 S690 Metabotropic glutamate receptor 7 S*VTAPR 0.17 0.257
Zc3hav1 Q8K3Y6 S325 Zinc finger CCCH-type antiviral protein 1 AS*QEFSEDGNLDDIFSR 0.16 0.003
Mdc1 Q5U2M8 S793 Mediator of DNA damage checkpoint protein 1 LFS*PVPEASASPQSLLTSQSQK 0.16 0.007
Stau2 Q68SB1 S456;S458 Double-stranded RNA-binding protein Staufen homolog 2 DMNQPSSSFFSVES*PS*PTSSAPAAR 0.16 0.008
Gtpbp1 D2XV59 S6 GTP-binding protein 1 S*RSPVDSPVPASM@FAPEPS?SPGAAR 0.16 0.009
Kif1b O88658 S1075 Kinesin-like protein KIF1B IVEGQGQSSEVIS*PPEEVNR 0.16 0.011
Rab11fip1 Q3B7T9 S198;S205 Rab11 family-interacting protein 1 DNTSDTASAIVPS*TTPSVDS*DDESFSK 0.16 0.011
Ascc3 F1LPQ2 T548 Activating signal cointegrator 1 complex subunit 3 ALAAEMT*NYFSK 0.16 0.012
Ei24 Q4KM77 S313;S330 Etoposide-induced protein 2.4 homolog TVYLQS*ALSSSSSAEKFPSPHPS*PAK 0.16 0.015
Prkaa2 Q09137 S501 5'-AMP-activated protein kinase catalytic subunit alpha-2 SS*VDSSTAENHSLSGSLTGSLTGSTLSSASPR 0.16 0.015
Ar P15207 S75 Androgen receptor QQHPEDGS*PQAHIR 0.16 0.016
Sort1 O54861 S819 Sortilin SGYHDDS*DEDLLE 0.16 0.019
Mpp7 Q5U2Y3 S409 MAGUK p55 subfamily member 7 S*QESDGVEYIFISK 0.16 0.019
Krt18 Q5BJY9 S57 Keratin, type I cytoskeletal 18 SVWGGS*VGSAGLAGMGGVQTEK 0.16 0.021
Mphosph8 G3V8T1 S51 M-phase phosphoprotein 8 GTVAVGDS*EEDGEDVFEVER 0.16 0.022
Ssb P38656 S94 Lupus La protein homolog SPS*RPLPEVTDEYK 0.16 0.022
Pde4d P14270 S205;S206 cAMP-specific 3',5'-cyclic phosphodiesterase 4D N$S*S*IAS?DIHGDDLIVTPFAQVLASLRTVR 0.16 0.024
Pdcl Q63737 S293;S296 Phosducin-like protein NSATC^HS*EDS*DLEID 0.16 0.024
Supt20h Q66HC7 S515;S520 Transcription factor SPT20 homolog KSS?VDLSQVSMLS*PAALS*PASSSQR 0.16 0.024
Myo9a Q9Z1N3 S2448 Unconventional myosin-IXa AS*DDEALESEASIGTADSSENLNM@DPEER 0.16 0.024
Ruvbl1 P60123 T139 RuvB-like 1 EVYEGEVT?ELT*PC^ETENPMGGYGK 0.16 0.025
Prdm2 Q63755 S622 PR domain zinc finger protein 2 STQVSVTDDLLKDS*PSSTNC^ESK 0.16 0.025
Mpdz O55164 T822 Multiple PDZ domain protein ADLALIDT*PDAESVAESR 0.16 0.027
Pag1 Q9JM80 S292;S293 Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 FS*S*LSYK 0.16 0.028
Fam129b B4F7E8 S641;S645;S648 Niban-like protein 1 QVVSVVQ#DEESGLPFEAGS*EPPS*PAS*PDNVTELR 0.16 0.029
Slc14a2 Q62668 S67 Urea transporter 2 DLRSS?DEDS*HIVK 0.16 0.031
Crtc2 Q3LRZ1 T501 CREB-regulated transcription coactivator 2 LPPYPYSPPS?LVIPSHPPT*PK 0.16 0.032
Dixdc1 Q2VUH7 S191 Dixin NAS*VDEEIENPYWSVR 0.16 0.032
Rrp15 Q5M947 S265;S279 RRP15-like protein DWDKES*EGEEPADGQAGSAS*H 0.16 0.033
Yipf1 Q6P6G5 S61 Protein YIPF1 EEDEELLGTNDS*DETELLAGQK 0.16 0.034
Ubxn2b P0C627 T232;S234;S235 UBX domain-containing protein 2B LGSLTPEIVST*PS*S*PEEEDK 0.16 0.036
Foxq1 Q63244 S90 Forkhead box protein Q1 TQAS*PVGPC^AGSVGGGEGAR 0.16 0.036
Phf20l1 Q4V9H5 S313 PHD finger protein 20-like protein 1 KEDC^SATAPVLEQAIS*PKPQSQK 0.16 0.037
Kat6a Q5TKR9 S1114 Histone acetyltransferase KAT6A DEEEEEEES*DDADDTPVLKPVSLLR 0.16 0.038
Osbpl1a Q8K4M9 S515 Oxysterol-binding protein-related protein 1 MS*EGKDC^GGGDALSN#GIK 0.16 0.038
Srprb Q4FZX7 S110 Signal recognition particle receptor subunit beta GNS*LTLIDLPGHESLR 0.16 0.038
Mdc1 Q5U2M8 S350;S354;T356 Mediator of DNA damage checkpoint protein 1 GVAHLQDS*PTGS*DT*DVEEDK 0.16 0.038
Nexn Q9Z2J4 S330 Nexilin S*MVLDDDSPEIYK 0.16 0.038
Cds1 O35052 T36;T41 Phosphatidate cytidylyltransferase 1 EGEAAGGDHETEST*SDKET*DIDDR 0.16 0.039
Fxyd4 Q63113 S86;T87 FXYD domain-containing ion transport regulator 4 VTPLITPGSAS*T* 0.16 0.04
Mink1 F1LP90 S927 Misshapen-like kinase 1 SLLLADSN#GYTNLPDVVQPSHSPTENS*QGQSPPTK 0.16 0.041
Cabin1 O88480 T2113;T2116;S2121 Calcineurin-binding protein cabin-1 FPPEITVT*PPT*PTLLS*PK 0.16 0.041
Smarcd2 O54772 T221 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 ADGDNSGTAGTPGGT*PAADK 0.16 0.042
Abca2 Q9ESR9 S1410 ATP-binding cassette sub-family A member 2 GDEGAGYTDGYGDYRPLFDN#LQDPDSVS*LQEAEM@EALAR 0.16 0.044
Pi4ka O08662 S250;S254 Phosphatidylinositol 4-kinase alpha TS*SVSS*ISQVSPER 0.16 0.045
Ring1 Q6MGB6 S38 E3 ubiquitin-protein ligase RING1 TPQEAIMDGTEIAVS*PR 0.16 0.047
Jup Q6P0K8 S665 Junction plakoglobin RVS*VELTNSLFK 0.16 0.051
Lpar1 P61794 S344;S346;S347 Lysophosphatidic acid receptor 1 S*AS*S*LNHTILAGVHSNDHSVV 0.16 0.052
Phf10 Q4V7A6 S21;S26;S35 PHD finger protein 10 RC^DSDPAS*PGAQS*PKDDNEDNS*NDGGHPSK 0.16 0.052
Retreg2 Q3MHU5 T325;T329 Reticulophagy regulator 2 ATT*PQLT*DVSEDLDQQSLPSEPEEALSR 0.16 0.055
Epb41l1 Q9WTP0 S648 Band 4.1-like protein 1 DKS*DSETEGLVFAR 0.16 0.056
Apc P70478 S1368 Adenomatous polyposis coli protein S*PPEHYVQETPLVFSR 0.16 0.058
Gsk3a P18265 S21;S41 Glycogen synthase kinase-3 alpha TSS*FAEPGGGGGGGGGGPGGSAS*GPGGTGGGK 0.16 0.06
Pdlim2 Q6AYD6 S210 PDZ and LIM domain protein 2 LSS*LDLEEDSEVFK 0.16 0.061
Numb Q2LC84 S237;S239;S243 Protein numb homolog TVGPSVAPGNSAPS*PS*SPTS*PTLDPTASLEMNNPHAIPR 0.16 0.062
Zcrb1 Q499V6 S155 Zinc finger CCHC-type and RNA-binding motif-containing protein 1 KVPEPEEEIEEVEVS*EEEGEDPALDSLSQ#AIAFQ#QAK 0.16 0.063
Dek Q6AXS3 T14;T16;S20 Protein DEK S$AAAAPAAEGEDT*PT*PPAS*EKEPEMPGPR 0.16 0.063
Wnk1 Q9JIH7 S2116 Serine/threonine-protein kinase WNK1 SIS*NPPGSNLR 0.16 0.063
Sh3rf1 Q71F54 S114 E3 ubiquitin-protein ligase SH3RF1 DLQS*PQC^GQQPR 0.16 0.069
Bcar1 Q63767 S746 Breast cancer anti-estrogen resistance protein 1 FTSQDS*PDGQYENSEGGWMEDYDYVHLQGK 0.16 0.069
Spice1 Q5RKG1 S776 Spindle and centriole-associated protein 1 LVGLTLSSSPVS*PVESPLR 0.16 0.069
Washc2 Q80X08 S610;S611 WASH complex subunit 2 ASALFS*S*DEEDQWSVADSQTK 0.16 0.07
Hp1bp3 Q6P747 S74;T85 Heterochromatin protein 1-binding protein 3 LAEGEEEKPEPDGSSEES*ISTVEEPEN#ET*PPAPSR 0.16 0.07
Atp7a P70705 S353;S356;S360 Copper-transporting ATPase 1 VSISSEVES*PTS*SPSS*SSLQK 0.16 0.072
Tomm70 Q75Q39 S255 Mitochondrial import receptor subunit TOM70 NREPLMPS*PQFIK 0.16 0.073
Epn1 O88339 S418 Epsin-1 TALPTSGS*STGELELLAGEVPAR 0.16 0.075
Akap12 Q5QD51 S268;S271;S274 A-kinase anchor protein 12 EPTKS*PES*PSS*PVSSETTSSFK 0.16 0.076
Farp1 F1LYQ8 S875 FERM, RhoGEF and pleckstrin domain-containing protein 1 SN#GPTPELLAS*SPPDN#KSPDEATAADQESEDDLSASR 0.16 0.076
Gnl3 Q811S9 S468 Guanine nucleotide-binding protein-like 3 DIPEES*PKQTEDQQ#DGDDQEHVTGEK 0.16 0.081
Dclk1 O08875 S23;S27;S30 Serine/threonine-protein kinase DCLK1 SGKS*PSPS*PTS*PGSLRK 0.16 0.083
Nup98 P49793 T708 Nuclear pore complex protein Nup98-Nup96 N#GLEGSSEET*SFHDESLQDDRDEIENSAFQIHPAGIVLTK 0.16 0.086
Pla2g4a P50393 S727 Cytosolic phospholipase A2 C^S*VSLSNVEAR 0.16 0.087
Bin1 O08839 S296;S298 Myc box-dependent-interacting protein 1 GNKS*PS*PPPDGSPAATPEIR 0.16 0.088
Map3k7 P0C8E4 S389 Mitogen-activated protein kinase kinase kinase 7 RMS*ADMSEIEAR 0.16 0.089
Armcx3 Q5XID7 S67 Armadillo repeat-containing X-linked protein 3 YNDWSDDDDDS*NESK 0.16 0.092
Pex14 Q642G4 S274;S275 Peroxisomal membrane protein PEX14 SPSPSSPAAVNHHSSSDISPVSNESPSS*S*PGK 0.16 0.094
Lzts3 Q8K1Q4 T286 Leucine zipper putative tumor suppressor 3 IGT*PGYSSGGGGGGSGYQDLGTSDSGR 0.16 0.095
Gsk3a P18265 S447 Glycogen synthase kinase-3 alpha S*PSGPATLTSSSQALTETQTGQDWQAPDATPTLTNSS 0.16 0.096
Krt18 Q5BJY9 S7 Keratin, type I cytoskeletal 18 S*TTFSTN#YR 0.16 0.101
Nucks1 Q9EPJ0 S223;S229;S234 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 KTSAS*PPLEKS*GDEGS*EDEAASGED 0.16 0.102
Sidt2 D3ZEH5 S401;S403;S404 SID1 transmembrane family member 2 LDS*M@S*S*VEEDDYDTLTDIDSDK 0.16 0.103
Hbs1l Q6AXM7 T207 HBS1-like protein GPPGDDVSIASPNVPETGT*PK 0.16 0.103
Hp1bp3 Q6P747 S110 Heterochromatin protein 1-binding protein 3 GEPESGEKEESKS*AEETK 0.16 0.104
Fam129b B4F7E8 T745 Niban-like protein 1 VSSPGSRPPIHTTTEDSAGVQT*EF 0.16 0.106
Zbtb38 Q5EXX3 S130 Zinc finger and BTB domain-containing protein 38 NFSNS*PGPYVVC^ITEK 0.16 0.106
Luzp1 Q9ESV1 S660 Leucine zipper protein 1 EKPDS*DDDLDIESLVTAK 0.16 0.107
Akap11 Q62924 S595;S598 A-kinase anchor protein 11 YPS*C^ES*VTDEYAGHIIQVLK 0.16 0.111
Chd8 Q9JIX5 S1995;S1997;S2008 Chromodomain-helicase-DNA-binding protein 8 TAS*PS*PLRPDVPAEKS*PEENAVQVPSLDSLTLK 0.16 0.111
Actb P60711 S233 Actin, cytoplasmic 1 LC^YVALDFEQ#EM@ATAASS*SSLEK 0.16 0.114
Lrrfip1 Q66HF9 S328 Leucine-rich repeat flightless-interacting protein 1 S*PEQIESHEVTNK 0.16 0.115
Mecp2 Q00566 S409 Methyl-CpG-binding protein 2 APMPLLPPPPPPEPQSSEDPISPPEPQDLSSS*IC^KEEK 0.16 0.117
Afdn O35889 S1804 Afadin LFS*Q#GQDVSDK 0.16 0.118
Emcn Q6AY82 S226 Endomucin DPGTPESGNDQPQSDKES*VK 0.16 0.118
Add3 Q62847 S680 Gamma-adducin TEEVLSPDGSPSKS*PSK 0.16 0.118
Pik3c3 O88763 S455 Phosphatidylinositol 3-kinase catalytic subunit type 3 DSQ#ASVSESLSSSGVSSADIDSSQ#IITNPLPPVAS*PPPASK 0.16 0.12
Phrf1 Q63625 S1106 PHD and RING finger domain-containing protein 1 SGS*PGSSSC^ER 0.16 0.126
Nup98 P49793 T670;S673 Nuclear pore complex protein Nup98-Nup96 FYTNPIAKPIPQT*PES*AGNK 0.16 0.126
Ampd3 O09178 S100;S106 AMP deaminase 3 GPPS*VSPAMS*PTTPLVLGAASKPGLAPYDMPEYQR 0.16 0.127
Nrdc P47245 S85 Nardilysin LGADES*EEEGR 0.16 0.13
Hmgcr P51639 S871 3-hydroxy-3-methylglutaryl-coenzyme A reductase S*KINLQDLQGTC^TK 0.16 0.13
Ptk2 O35346 S840;S843 Focal adhesion kinase 1 LS*RGS*IDREDGSFQGPTGNQ#HIYQPVGKPDPAAPPK 0.16 0.133
Ppm1g F1LNI5 S524 Protein phosphatase 1G LEEALS*TEGAEEN#GNSDK 0.16 0.133
Zc3h18 Q6TQE1 S63;S70;S74;S79 Zinc finger CCCH domain-containing protein 18 VQSQEEIHS*DEEDQ#AS*EPKS*QDQDS*EAHELSR 0.16 0.135
Afdn O35889 S557;S561 Afadin LDS*DRVS*SASS?TAER 0.16 0.138
Hsph1 Q66HA8 S832 Heat shock protein 105 kDa KEDLEGKS*N#LGADAPHQN#GEC^HPNEK 0.16 0.142
Zhx3 Q80Z36 T120 Zinc fingers and homeoboxes protein 3 T*PEGLSLHNAK 0.16 0.144
Cdk18 O35832 S417 Cyclin-dependent kinase 18 VHQLDDTAS*IFSLK 0.16 0.147
Esyt1 Q9Z1X1 S610 Extended synaptotagmin-1 LPTEPGAQDWDSES*PETGSSVDAPPRPYHTTPN#SHFGTENVLR 0.16 0.149
Myh3 P12847 S1646 Myosin-3 S*VQ#GQLK 0.16 0.156
Ppig O55035 S584;S586 Peptidyl-prolyl cis-trans isomerase G S*RS*KEYHR 0.16 0.162
Per3 Q8CJE2 T491;S496 Period circadian protein homolog 3 SS?VKPVMETC^T*EPQGS*DEQ#K 0.16 0.162
Tgs1 P85107 S601 Trimethylguanosine synthase SEGGSLVAAVPENC^STEGVANS*PR 0.16 0.167
Me1 P13697 S346 NADP-dependent malic enzyme GRAS*LTEEK 0.16 0.169
Pde4d P14270 S205;S206;S209 cAMP-specific 3',5'-cyclic phosphodiesterase 4D N$S*S*IAS*DIHGDDLIVTPFAQVLASLRTVR 0.16 0.17
Srek1ip1 Q5RJP9 S94;S97 Protein SREK1IP1 RS*NSS*TTEEDSSK 0.16 0.191
Ncoa3 Q9EPU2 S551;S554;S557 Nuclear receptor coactivator 3 (Fragment) ALS*LDS*PVS*VGSVPPVK 0.16 0.197
Rhbdf1 Q499S9 S8 Inactive rhomboid protein 1 DS*TSSLQR 0.16 0.198
Myo1e Q63356 S1001;S1008 Unconventional myosin-Ie QQS*TGSDRLS*QTPESLDFLK 0.16 0.199
Hdac4 Q99P99 S630 Histone deacetylase 4 AQS*SPASATFPMSVQ#EPPTKPR 0.16 0.213
Akap12 Q5QD51 S507 A-kinase anchor protein 12 LFS*SSGLK 0.16 0.214
Kalrn P97924 S1536 Kalirin AS*N#IETK 0.16 0.224
Phrf1 Q63625 S1104;S1106 PHD and RING finger domain-containing protein 1 S*GS*PGSSSC^ER 0.16 0.228
Taldo1 Q9EQS0 S4 Transaldolase S$GS*PVK 0.16 0.235
Tra2b P62997 S95;S99 Transformer-2 protein homolog beta HS*HSHS*PMSTR 0.16 0.235
Srsf2 Q6PDU1 S206;S208;S212;S221 Serine/arginine-rich splicing factor 2 S*KS*PPKS*PEEEGAVSS* 0.16 0.239
Fra10ac1 Q5FVF1 S243 Protein FRA10AC1 homolog TESDES*PHK 0.16 0.251
Rere Q62901 S612 Arginine-glutamic acid dipeptide repeats protein NS*PSAASTSSNDSK 0.16 0.267
Inpp5j Q9JMC1 S905;S907;S912 Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A GGS*RS*PSPQS*R 0.16 0.29
Rtn4 Q9JK11 S66 Reticulon-4 KPAAGLS*AAAVPPAAAAPLLDFSSDSVPPAPR 0.15 5.50E-04
Afdn O35889 S1208 Afadin ITSVS*TGNLC^TEEQ#TPPPRPEAYPIPTQTYTR 0.15 5.69E-04
Eif2ak4 D4A7V9 S467 eIF-2-alpha kinase GCN2 FS*DSALPYK 0.15 9.95E-04
Ostf1 Q6P686 S202;S213 Osteoclast-stimulating factor 1 TLS*N#AEDYLDDEDS*D 0.15 0.001
Hpdl Q5XIH9 T371 4-hydroxyphenylpyruvate dioxygenase-like protein ALWQSVQ#EEAARAQGT* 0.15 0.001
Rrp15 Q5M947 S265 RRP15-like protein DWDKES*EGEEPADGQAGSASH 0.15 0.002
Hnrnpm Q62826 S29 Heterogeneous nuclear ribonucleoprotein M M@EEESGAPC^VPS*GN#GAPVPK 0.15 0.004
Macf1 D3ZHV2 S5387;S5390 Microtubule-actin cross-linking factor 1 GSDASDFDLLETQ#SAC^S*DTS*ESSAAGGQGSSR 0.15 0.004
Cep44 Q3B7T8 S137 Centrosomal protein of 44 kDa S*ISEKPEPC^SSR 0.15 0.006
Trio F1M0Z1 S2459;S2463 Triple functional domain protein TRPGAVS*PLNS*PLSTTFPSPFGK 0.15 0.006
Raf1 P11345 S244 RAF proto-oncogene serine/threonine-protein kinase YSTPHAFTFNTSS*PSSEGSLSQR 0.15 0.007
Nup98 P49793 S932 Nuclear pore complex protein Nup98-Nup96 TAPLPPAGQATTFQMTLN#GKPAPPPQS*QSPEVEQLGR 0.15 0.008
Cttn Q66HL2 S381;Y384 Src substrate cortactin KQTPPASPS?PQPAEDRPPSS*PIY*EDAAPLK 0.15 0.009
Jund P52909 S253 Transcription factor jun-D DEPQTVPDVPSFGDSPPLS*PIDMDTQER 0.15 0.01
Luzp1 Q9ESV1 S57 Leucine zipper protein 1 VIQAEGS*NSSM@LAEIEVLR 0.15 0.01
Ptpn21 Q62728 S374;S377 Tyrosine-protein phosphatase non-receptor type 21 N#GFYC^HS*QTS*LDR 0.15 0.012
Tmem55b Q5PPM8 S76 Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase HAPPQAFPPFPEGHPAVLPGEDPPPYS*PLTSPDSGSAPMITC^R 0.15 0.012
Cdc5l O08837 T385 Cell division cycle 5-like protein GGLNT*PLHESDFSGVT?PQR 0.15 0.012
Ik Q66HG8 S402 Protein Red VDDEPMDVDKGPGS*AK 0.15 0.013
Kat7 Q810T5 S125;T129;S145 Histone acetyltransferase KAT7 NTADHDES*PPRT*PTGN#APSSESDIDISS*PNVSHDESIAK 0.15 0.015
Myo9b Q63358 S1103;S1108 Unconventional myosin-IXb S*PN#GLS*PK 0.15 0.016
Gnas Q63803 S612 Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas AAAAARAAS*AARAVAAGR 0.15 0.016
Mark2 O08679 S409;S421 Serine/threonine-protein kinase MARK2 SS*DQAVPAIPTSNS*YSK 0.15 0.017
Snx3 Q5U211 S72 Sorting nexin-3 YS*DFEWLR 0.15 0.017
Leo1 Q641X2 S224;S232;S241;S250 RNA polymerase-associated protein LEO1 GNS*DDERPAAS*DNDEEKQNS*DDEDRPQVS*DEEK 0.15 0.018
Casc3 Q8K3X0 S34 Protein CASC3 GGGS*C^SGSAGGGGSGSLPSQR 0.15 0.018
Akap11 Q62924 S133 A-kinase anchor protein 11 NTC^LPSELSPC^SQ#NDFKPTNGDIDMQS*PSK 0.15 0.019
Crkl Q5U2U2 S114 Crk-like protein YPNPPMGSVS*APNLSTAEENLEYVR 0.15 0.019
Cavin1 P85125 T40;S42 Polymerase I and transcript release factor ATEEPSGT*GS*DELIK 0.15 0.019
Cmtr1 Q5U2Z5 S27;S30 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 HLS*STS*DDEPLSSVSHAAK 0.15 0.02
Rtn4 Q9JK11 T528 Reticulon-4 VTEAAVSNMPEGLT*PDLVQEAC^ESELNEATGTK 0.15 0.021
Pfkp P47860 S10 ATP-dependent 6-phosphofructokinase, platelet type S$DQDSSTSS*TSFPK 0.15 0.021
Synpo2 D4A702 S724 Synaptopodin-2 GTGAGGDS*GPEEDYLSLGAEAC^N#FM@QSSAK 0.15 0.022
Fos P12841 S133 Proto-oncogene c-Fos VEQLS*PEEEEK 0.15 0.023
Clic1 Q6MG61 T145 Chloride intracellular channel protein 1 VLDNYLT*SPLPEEVDETSAEDEGISQR 0.15 0.023
Ralbp1 Q62796 S62 RalA-binding protein 1 TGEPSPPHDILHEPPDIVS*DDEK 0.15 0.025
Ssbp3 Q9R050 S320;T333 Single-stranded DNA-binding protein 3 NS*PN#NISGISNPPGT*PR 0.15 0.025
Zdhhc5 Q2THW7 S425 Palmitoyltransferase ZDHHC5 SFHFDPLSSGS*R 0.15 0.026
Tmem209 Q68FR5 S9 Transmembrane protein 209 M@M@QGEVSPS*PSLIDR 0.15 0.027
Ndrg2 Q8VBU2 S332;S335;S338 Protein NDRG2 TAS*LTS*AAS*IDGSR 0.15 0.028
Zdhhc5 Q2THW7 S577 Palmitoyltransferase ZDHHC5 EEEPGLGDSGIQSTPGS*GHAPR 0.15 0.028
Tram1 Q5XI41 T350 Translocating chain-associated membrane protein 1 KGT*EN#GVN#GTVTSN#GADSPR 0.15 0.029
Zbtb44 Q3SWU4 S148 Zinc finger and BTB domain-containing protein 44 GLDAGQENS*SNC^NFTSR 0.15 0.031
Usp10 Q3KR59 S209;S224 Ubiquitin carboxyl-terminal hydrolase 10 TC^DS*PQNPM@DLISDPVPDS*PFPR 0.15 0.032
Map1b P15205 T109;S116 Microtubule-associated protein 1B SDVLET*VVLIN#PS*DEAVSTEVRLM@ITDAAR 0.15 0.034
Pgrmc2 Q5XIU9 T205 Membrane-associated progesterone receptor component 2 LLKPGEEPSEYT*DEEDTK 0.15 0.034
Map2 P15146 S1816;S1820;S1821;S1824 Microtubule-associated protein 2 VDHGAEIITQS*PSRS*S*VAS*PR 0.15 0.035
Prkcz P09217 S206 Protein kinase C zeta type HMDSVMPSQEPPVDDKNDGVDLPS*EETDGIAYISSSR 0.15 0.035
Ric8b Q80ZG0 S220 Synembryn-B WTDEYESAIDHSGPPLS*PQETDC^AIEALK 0.15 0.036
Szrd1 Q5XIA2 S105;T121 SUZ domain-containing protein 1 ILGS*ASPEEEQEKPILDRPT*R 0.15 0.038
Slk O08815 S649 STE20-like serine/threonine-protein kinase ATTEEPETDEVDQVSESNS*IEELER 0.15 0.04
Epb41l1 Q9WTP0 T30;T33 Band 4.1-like protein 1 AQEETPQQPEAAAAVTT*PVT*PAGHSHPETNSN#EK 0.15 0.041
Tcf4 Q62655 S433 Transcription factor 4 GMPPGLQGQSVSSGSSEIKS*DDEGDEN#LQDTK 0.15 0.042
Mid1ip1 Q6P7D5 S110 Mid1-interacting protein 1 NDIEWGVLHQPS*SPPAGSEEGTWKPK 0.15 0.043
Ablim2 Q6KC51 S279 Actin-binding LIM protein 2 TS*SESIVSVPASSTSGSPSR 0.15 0.046
Arhgef28 P0C6P5 S557 Rho guanine nucleotide exchange factor 28 SYS*C^SSPK 0.15 0.048
Hnrnpc G3V9R8 S226 Heterogeneous nuclear ribonucleoprotein C NEKS*EEEQSSASVK 0.15 0.05
Pebp1 P31044 S52 Phosphatidylethanolamine-binding protein 1 VLTPTQVMNRPSS*ISWDGLDPGK 0.15 0.051
Map2 P15146 S397 Microtubule-associated protein 2 VADVPVSEATTVLGDVHS*PAVEGFVGENISGEEK 0.15 0.053
Anks6 P0C0T2 S734;S742 Ankyrin repeat and SAM domain-containing protein 6 STS*PTLTPSPS*PK 0.15 0.054
Adra2a P22909 S296;S297;S298 Alpha-2A adrenergic receptor DGDALDLEES*S*S*SEHAERPQGPGKPER 0.15 0.054
Afap1l1 D4AB98 S746 Actin filament-associated protein 1-like 1 SPS*IVTSNQGR 0.15 0.054
Map3k1 Q62925 S910 Mitogen-activated protein kinase kinase kinase 1 LSAS*SEDISDR 0.15 0.055
Sipa1l1 O35412 S1408;S1411 Signal-induced proliferation-associated 1-like protein 1 KTES*SLS*LDIHSK 0.15 0.055
Ncoa2 Q9WUI9 S396 Nuclear receptor coactivator 2 EQNVC^VMNPDLTGQAMGKPLS*PMSSSSPAR 0.15 0.057
Tle3 Q9JIT3 S240;T259 Transducin-like enhancer protein 3 YDS*DGDKSDDLVVDVSNEDPAT*PR 0.15 0.057
Akap11 Q62924 S434;S439 A-kinase anchor protein 11 SLS*EEVES*SEGEEHPEMDVK 0.15 0.057
Dnajc5 P60905 S191 DnaJ homolog subfamily C member 5 EATDTPIVIQPASATETTQLTADSHPS*YHTDGFN 0.15 0.057
Wdr44 Q9R037 S556;S558 WD repeat-containing protein 44 VS*PS*PSQESLSSSK 0.15 0.058
Ring1 Q6MGB6 S190;S194 E3 ubiquitin-protein ligase RING1 RPMPGSDQ#TTTMSGGEGEPGEGEGDGEDIS?SDS*APDS*APGPAPK 0.15 0.058
Wrnip1 Q8CG07 T87;S91;S92 ATPase WRNIP1 QPATPT*AAES*S*EGEGEEGDDGGETESR 0.15 0.06
Bag6 Q6MG49 S978 Large proline-rich protein BAG6 TS*PEPQREDASPAPGTTAEEAMSR 0.15 0.062
Pelp1 Q56B11 T1082 Proline-, glutamic acid- and leucine-rich protein 1 VPPPPET*PAQ#EEMETETEASAPQGK 0.15 0.064
Phldb1 Q63312 S189 Pleckstrin homology-like domain family B member 1 (Fragment) SDEENLKEEC^S*S?TES?TQQEHEDAPSTK 0.15 0.065
Arhgef1 Q9Z1I6 T313 Rho guanine nucleotide exchange factor 1 TVGT*PGQDNPGVSLHPLSVDSLDSR 0.15 0.065
Psmb4 P34067 S98 Proteasome subunit beta type-4 VNDSTMLGAS*GDYADFQYLK 0.15 0.067
Synpo2 D4A702 S220 Synaptopodin-2 FKS*PDPDWGTQHGR 0.15 0.068
Hsph1 Q66HA8 S555 Heat shock protein 105 kDa NIQQDNSEAGTQPQ#VQTDGQQTSQS*PPSPELTSEENK 0.15 0.068
Insr P15127 S1351 Insulin receptor EGGSS?LS*IKR 0.15 0.068
Apc P70478 S1357 Adenomatous polyposis coli protein AVEFSSGAKS*PSK 0.15 0.069
Nucks1 Q9EPJ0 S19 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 KVVDYSQFQ#ES*DDADEDYGR 0.15 0.069
Epn3 Q4V882 S417;S419 Epsin-3 GKS*PS*PVELDPFGDSSPSC^K 0.15 0.069
Pds5b Q6TRW4 S1283 Sister chromatid cohesion protein PDS5 homolog B EELLGNEDEQNS*PPK 0.15 0.07
Mfap3l Q6AYP2 S298;T300;S306;S307 Microfibrillar-associated protein 3-like SES*PT*ADSDAS*S*LHEQPQQIAIK 0.15 0.072
Sptan1 P16086 S1578 Spectrin alpha chain, non-erythrocytic 1 LQTASDES*YKDPTNIQSK 0.15 0.077
Tbc1d14 Q5CD77 S442 TBC1 domain family member 14 SLS*TGGSEVENEDAGFSAADR 0.15 0.077
H2afy Q02874 S169;S172 Core histone macro-H2A.1 AAS*ADS*TTEGAPTDGFTVLSTK 0.15 0.079
Ptpn1 P20417 S50 Tyrosine-protein phosphatase non-receptor type 1 DVS*PFDHSR 0.15 0.08
Ubn2 D4A666 S570 Ubinuclein-2 N#GS*DDDDDEKPGK 0.15 0.08
Dcaf11 Q5M9G8 S11 DDB1- and CUL4-associated factor 11 NSSSAGS*GSLEPSEGLSR 0.15 0.081
Wdr5b Q4V8C4 S13 WD repeat-containing protein 5B AQS*PLSAPQR 0.15 0.081
Clip1 Q9JK25 S194;S199 CAP-Gly domain-containing linker protein 1 TASES*ISNLS*EAGSVK 0.15 0.082
Wnk4 Q7TPK6 S1196 Serine/threonine-protein kinase WNK4 NS*LSGSSTGSQEQR 0.15 0.082
Tanc1 Q6F6B3 S204;S211 Protein TANC1 TAANKS*PC^ETISS*PSSTLESK 0.15 0.083
Ank3 O70511 S1458 Ankyrin-3 QS*FTSLALR 0.15 0.084
Nkap Q4V7C9 S147 NF-kappa-B-activating protein IGELGAPEVWGLS*PK 0.15 0.086
Slc4a1 P23562 S226 Band 3 anion transport protein LYC^AQAEGGSEEPS*PSGILK 0.15 0.087
Scaf1 Q63624 T938;T943 Splicing factor, arginine/serine-rich 19 VAPPPPALT*PDSQT*VDSSC^KTPEVSFLPEEASEDTGVR 0.15 0.088
Rnf146 Q5XIK5 T286;S288 E3 ubiquitin-protein ligase RNF146 VPDTSTEET*ES*DAS?SDIEDAPVVVAQ#HSLTQQR 0.15 0.089
Pacsin2 Q9QY17 S448 Protein kinase C and casein kinase substrate in neurons 2 protein ALYDYEGQEHDELS*FK 0.15 0.089
Hp1bp3 Q6P747 S70;S71;S74 Heterochromatin protein 1-binding protein 3 LAEGEEEKPEPDGS*S*EES*ISTVEEPEN#ETPPAPSR 0.15 0.09
Shank3 Q9JLU4 S375;S387 SH3 and multiple ankyrin repeat domains protein 3 SAS*DINLKGDQPAAS*PGPTLR 0.15 0.092
Smarcad1 D3Z9Z9 S34;S37 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 IEEAPEAAPQPSQPGPSS*PIS*LSAEEENAEGEVSR 0.15 0.093
Acbd4 Q6DGF9 S238 Acyl-CoA-binding domain-containing protein 4 SSPES*PEGFGGSLMGPQELDR 0.15 0.093
Myo1d Q63357 T834;T840 Unconventional myosin-Id AWEGNYLASKPDT*PQTSGT*FVPVANELK 0.15 0.097
Map2 P15146 S1816;S1818;S1820;S1821;S1824 Microtubule-associated protein 2 VDHGAEIITQS*PS*RS*S*VAS*PR 0.15 0.097
Hnrnph1 Q8VHV7 S63 Heterogeneous nuclear ribonucleoprotein H EGRPSGEAFVELES*EDEVK 0.15 0.1
Pak1 P35465 S219;S222 Serine/threonine-protein kinase PAK 1 DVATS*PIS*PTENNTTPPDALTR 0.15 0.102
Dlgap1 P97836 S425 Disks large-associated protein 1 S*LDSLDPAGLLTSPK 0.15 0.102
Ddb1 Q9ESW0 S766 DNA damage-binding protein 1 IEVQDTSGGTTALRPSASTQALSSSVS*SSK 0.15 0.102
Sh2b1 Q62985 S96 SH2B adapter protein 1 ASGSLSPPVLAPLS*PGVEIPPSHDLSLESC^R 0.15 0.107
Dbi P11030 Y29 Acyl-CoA-binding protein TQ#PTDEEMLFIY*SHFK 0.15 0.107
Emcn Q6AY82 T212 Endomucin DPGT*PESGNDQPQSDK 0.15 0.108
Emd Q63190 S142;S143;S144 Emerin DDIFS*S*S*EEEGKDR 0.15 0.112
Znf652 A1L1J6 S196;T202 Zinc finger protein 652 AAS*VAAATT*SPTPR 0.15 0.113
Ubr5 Q62671 S601 E3 ubiquitin-protein ligase UBR5 TEMGPPPS*PASTC^SDASSIASSASMPYK 0.15 0.114
Ralgapa2 P86411 S373;S375;S379 Ral GTPase-activating protein subunit alpha-2 RLS*NS*SLC^S*IEEEHR 0.15 0.115
Fam168b D4AEP3 S63 Myelin-associated neurite-outgrowth inhibitor VSC^S*PTSGAVPPYSSSPNPYQTAVYPVR 0.15 0.116
Ube2z Q3B7D1 S343;S344 Ubiquitin-conjugating enzyme E2 Z LHNEN#AEMDSDS?S?S*S*GTETDLHGSLR 0.15 0.119
Trim28 O08629 S684 Transcription intermediary factor 1-beta EEDGSLS*LDGADSTGVVAK 0.15 0.121
Zdhhc5 Q2THW7 S406 Palmitoyltransferase ZDHHC5 SEPSLEPES*FRSPTFGK 0.15 0.122
Arhgap24 Q5U2Z7 S574;T576 Rho GTPase-activating protein 24 SS*TT*TC^PEQDFYGGNFEDPVLDGPPQDDLSHPGDYENK 0.15 0.123
Farp1 F1LYQ8 S893;T902;S903 FERM, RhoGEF and pleckstrin domain-containing protein 1 SPDEATAADQES*EDDLSASRT*S*LER 0.15 0.126
Timeless Q9Z2Y1 S1121 Protein timeless homolog EEEPEPNPGVPGEQS*PSEEHQVR 0.15 0.131
Dync1li1 Q9QXU8 T513;S523 Cytoplasmic dynein 1 light intermediate chain 1 KPASVSPTT*PPSPTEGEAS* 0.15 0.132
Oxr1 Q4V8B0 S194;S195;S197 Oxidation resistance protein 1 VVS*S*TS*EEEEAFTEK 0.15 0.134
Arhgap27 Q6TLK4 S614 Rho GTPase-activating protein 27 EEGEPSSADFGS*SER 0.15 0.135
Pebp1 P31044 T42 Phosphatidylethanolamine-binding protein 1 VLT*PTQVMNRPSSISWDGLDPGK 0.15 0.14
Pkn2 O08874 S307 Serine/threonine-protein kinase N2 SSVVIEELSLVASPTLS*PR 0.15 0.14
Cpsf7 Q5XI29 S185;S188;T194 Cleavage and polyadenylation specificity factor subunit 7 AHSRDS*SDS*ADGRAT*PSENLVPSSAR 0.15 0.143
Abcc5 Q9QYM0 S505;S509 Multidrug resistance-associated protein 5 NATLAWDSSHSS*TQSS*PK 0.15 0.143
Pom121 P52591 S354;S355 Nuclear envelope pore membrane protein POM 121 SLASQ#S*S*DDHLNK 0.15 0.145
Lmna P48679 S570 Prelamin-A/C GS*HC^SSSGDPAEYNLR 0.15 0.146
Kif1b O88658 S245 Kinesin-like protein KIF1B IS*LVDLAGSER 0.15 0.146
Bcar1 Q63767 T334 Breast cancer anti-estrogen resistance protein 1 VGQGYVYEASQAEQDEYDT*PR 0.15 0.15
Plec P30427 S4616 Plectin GYYS*PYSVSGSGSTAGSR 0.15 0.15
Camk2d P15791 S368;T371 Calcium/calmodulin-dependent protein kinase type II subunit delta ESTESS*NTT*IEDEDVK 0.15 0.151
Rtn4 Q9JK11 S685 Reticulon-4 LS*TEPSPDFSNYSEIAK 0.15 0.157
Prrc2a Q6MG48 S1307;T1324;S1326 Protein PRRC2A TAAKS*PDLSNQNSDQANEEWET*AS*ES?SDFASER 0.15 0.158
Add1 Q63028 S457;S465 Alpha-adducin GDDAS*EEGQ#NGSS*PK 0.15 0.162
Ppig O55035 S252;S254;S255;S257 Peptidyl-prolyl cis-trans isomerase G SKKS*PS*S*ES*EADNVDAQPQSTVRPEEIPPIPENR 0.15 0.163
Zcchc2 Q498S6 S484;S485;S488;S489 Zinc finger CCHC domain-containing protein 2 ILEHLKEDS*S*EAS*S*QEEDVLQHTIIHK 0.15 0.166
Tmem79 Q3T1H8 S38 Transmembrane protein 79 SPPQASVLQ#PEEEGGTES*PGAESLR 0.15 0.167
Ndrg3 Q6AYR2 S352;T355;S358 Protein NDRG3 SVTSNQS*DGT*QES*C^ESPDVLDR 0.15 0.171
Ubr4 Q2TL32 S2718;S2722 E3 ubiquitin-protein ligase UBR4 HVTLPS*SPRS*NTPMGDKDDDDDDDADEK 0.15 0.173
Fam174a Q5FVQ7 T169 Membrane protein FAM174A YGVLDTN#IEN#MELT*PLEQDDEDDDNTLFDANHPR 0.15 0.175
Myo9a Q9Z1N3 S1584;S1593 Unconventional myosin-IXa GEAGVLGS*PSALATKDS*PSIHLPPK 0.15 0.177
Ubr4 Q2TL32 S2907 E3 ubiquitin-protein ligase UBR4 TSPADHGGSVGS*ESGGSAVDSVAGEHSVSGR 0.15 0.178
Cux1 P53565 S1321 Homeobox protein cut-like 1 AAPSSEGDS*C^DGVEAADTEEPGGNIVATK 0.15 0.179
Fcho2 D3ZYR1 S312 F-BAR domain only protein 2 DAESVEC^PDADS*LN#IPDVDEEGFSIKPEAN#QNDTK 0.15 0.181
Slc9a1 P26431 S707 Sodium/hydrogen exchanger 1 IGS*DPLAYEPK 0.15 0.182
Thrap3 Q5M7V8 S187;S190 Thyroid hormone receptor-associated protein 3 KSSS?KDS*RPS*QAAGDNQGDEAK 0.15 0.184
L3mbtl2 Q3MIF2 S681;S685 Lethal(3)malignant brain tumor-like protein 2 EEHQDLPS*PDRS*PSPLLPLPTESIK 0.15 0.185
Srek1 Q9JKL7 S391;S393 Splicing regulatory glutamine/lysine-rich protein 1 SS?RS*PS*PR 0.15 0.193
Strbp Q9JKU6 S465;S470 Spermatid perinuclear RNA-binding protein VLQAMGYPTGFDADIEC^M@S*SDEKS*DNESK 0.15 0.198
Arhgef28 P0C6P5 S1320 Rho guanine nucleotide exchange factor 28 LADVSQPSEEGPGGAVLADTLSAQDAPAS*PTAFTEGTEGR 0.15 0.213
Golga5 Q3ZU82 S179 Golgin subfamily A member 5 ATEENSGSQ#S*PEVSSSDSM@PEGHK 0.15 0.222
Psip1 Q812D1 S129 PC4 and SFRS1-interacting protein AS*NEDVTK 0.15 0.227
Btbd9 Q5PQR3 T578 BTB/POZ domain-containing protein 9 EDSSEEPGTGDLST*PSQQLDPHAPR 0.15 0.229
Canx P35565 S553;T561;S569 Calnexin QKS*DAEEDGGT*GSQDEEDS*KPKAEEDEILNR 0.15 0.23
Pfkm P47858 S775 ATP-dependent 6-phosphofructokinase, muscle type S*GEAAV 0.15 0.25
Usp42 D3ZU96 S959;S961 Ubiquitin carboxyl-terminal hydrolase 42 DRS*SS*GEHVR 0.15 0.251
Cttn Q66HL2 S261 Src substrate cortactin LQLHES*QKDYAK 0.15 0.253
Hnrnpc G3V9R8 S231;S234 Heterogeneous nuclear ribonucleoprotein C SEEEQS*SAS*VK 0.15 0.263
Srek1 Q9JKL7 S389;S391;S393 Splicing regulatory glutamine/lysine-rich protein 1 SS*RS*PS*PR 0.15 0.264
Thrap3 Q5M7V8 S737;S740;S743;S744 Thyroid hormone receptor-associated protein 3 SRES*VDS*RDS*S*HSR 0.15 0.27
Pcnp Q7TP40 S50 PEST proteolytic signal-containing nuclear protein TVSSS*N#GGESSSR 0.15 0.3
Rps6ka1 Q63531 T359;S363;S369 Ribosomal protein S6 kinase alpha-1 T*PRDS*PGIPPS*AGAHQLFR 0.14 0.001
Atp2b1 P11505 S1249 Plasma membrane calcium-transporting ATPase 1 SATSSSPGS*PLHSLETSL 0.14 0.002
Tnfaip1 Q7TNY1 S280 BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2 SQASPS*EDEDTFELR 0.14 0.003
Arhgap35 P81128 S1179 Rho GTPase-activating protein 35 TSFSVGS*DDELGPIR 0.14 0.004
Usp19 Q6J1Y9 S1020 Ubiquitin carboxyl-terminal hydrolase 19 ES*VSAHTPQFFIYK 0.14 0.007
Eif4ebp1 Q62622 T69;S99;S100 Eukaryotic translation initiation factor 4E-binding protein 1 T*PPKDLPTIPGVTSPTSDEPPMQASQ#SHLHS*S*PEDK 0.14 0.007
Senp7 D3ZF42 S432;S433 Sentrin-specific protease 7 EAPPPGGNSEENQLLMSAEPIVVS*S*DEEGPVEHK 0.14 0.007
Ccdc175 Q5PQJ9 Y104;T109 Coiled-coil domain-containing protein 175 LY*FLLET*VPNSMHK 0.14 0.007
Phrf1 Q63625 S1044;S1046 PHD and RING finger domain-containing protein 1 S*VS*PFTEEHTK 0.14 0.011
Slc9a1 P26431 S790;S793 Sodium/hydrogen exchanger 1 SKEPSS?PGTDDVFTPGPSDS*PGS*QR 0.14 0.011
Slc20a2 Q63488 S268 Sodium-dependent phosphate transporter 2 VQEAES*PVFK 0.14 0.012
Exoc4 Q62824 S226;T238 Exocyst complex component 4 DAS*PGPLIDVSNIST*PRK 0.14 0.012
Zdhhc5 Q2THW7 S395;S398 Palmitoyltransferase ZDHHC5 HPS*YRS*EPSLEPESFR 0.14 0.016
Raver1 Q5XI28 T469 Ribonucleoprotein PTB-binding 1 EPMGLGPPASQLT*PPPAPMGLR 0.14 0.018
Cdc42bpb Q7TT49 S1661 Serine/threonine-protein kinase MRCK beta SMS*DPDQ#DFDKEPDSDSTK 0.14 0.018
Gab2 Q9EQH1 S597;S612 GRB2-associated-binding protein 2 KS*TGSVDYLALDFQPGS*PSPHR 0.14 0.018
Trio F1M0Z1 S2459;S2463;S2466;S2471 Triple functional domain protein TRPGAVS*PLNS*PLS*TTFPS*PFGK 0.14 0.019
Mvd Q62967 S96 Diphosphomevalonate decarboxylase S*TGDGDALPLSLGYK 0.14 0.019
Afap1 Q8VH46 S688 Actin filament-associated protein 1 TLENSPISSC^DTS*DAEGPLPVNSAAVLK 0.14 0.021
Ddx46 Q62780 S804 Probable ATP-dependent RNA helicase DDX46 AALGLQDS*DDEDAAVDIDEQIESM@FNSK 0.14 0.021
Scaf1 Q63624 T950 Splicing factor, arginine/serine-rich 19 VAPPPPALTPDSQTVDSSC^KT*PEVSFLPEEASEDTGVR 0.14 0.022
Cavin2 Q66H98 S362 Serum deprivation-response protein GN#NSGVGS*NADLTIEEDEEEESVALQQAQQ#VR 0.14 0.022
Phyhipl Q6AYN4 S12;S15 Phytanoyl-CoA hydroxylase-interacting protein-like LDHALSS*PSS*PC^EEIK 0.14 0.022
Hp1bp3 Q6P747 S441;S442;S445 Heterochromatin protein 1-binding protein 3 KVSDGSEDEDEEEDEEES*S*EDS*EDEEPPPK 0.14 0.023
Plpp2 Q8K593 S260 Phospholipid phosphatase 2 SRPPQSC^QENEES*ER 0.14 0.023
Fosl2 P51145 S230 Fos-related antigen 2 QEPPEEDS*PSSSAGMDK 0.14 0.024
Gramd2b Q5FVG8 T233;S238 GRAM domain-containing protein 3 SIC^GHLENT*SVGNS*PNPSSAENSFR 0.14 0.025
Tmem230 Q5BJP5 S23 Transmembrane protein 230 LS*STDDGYIDLQFK 0.14 0.026
Cmtr1 Q5U2Z5 S27 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 HLS*ST?SDDEPLSSVSHAAK 0.14 0.027
Usp4 B2GUZ1 S674 Ubiquitin carboxyl-terminal hydrolase 4 EQLS*EVEESGEDSQGGDPTETTQK 0.14 0.029
Chp1 P61023 T7 Calcineurin B homologous protein 1 AST*LLRDEELEEIK 0.14 0.03
Znf689 Q99PJ7 T19 Zinc finger protein 689 M$APPSAPLLEQAPGEVGPT*R 0.14 0.031
Pxn Q66H76 S83;S85;S89 Paxillin YAHQQPPS*PS*PIYS*SSTK 0.14 0.034
Nos1 P29476 S1428 Nitric oxide synthase, brain DADEVFS*S 0.14 0.035
Ralbp1 Q62796 T27;S29;S30 RalA-binding protein 1 T*PS*S*EEISPTK 0.14 0.036
Pla2g4a P50393 S727;S729 Cytosolic phospholipase A2 C^S*VS*LSNVEAR 0.14 0.037
Arhgap29 Q5PQJ5 S352 Rho GTPase-activating protein 29 AEEEQLSSS*VGLGK 0.14 0.041
Hdgf Q8VHK7 S202 Hepatoma-derived growth factor N#STPS*EPDSGQ#GPPPEEEEGEEEAAKEEAEAQGVR 0.14 0.041
Pds5a A4L9P7 S1174 Sister chromatid cohesion protein PDS5 homolog A SAGTETGSNINASSELS*PSAGNR 0.14 0.041
Zc3h14 Q7TMD5 S475;T481 Zinc finger CCCH domain-containing protein 14 LS*EEIVVT*PNQDSGM@K 0.14 0.042
Dync1i1 Q63100 S633 Cytoplasmic dynein 1 intermediate chain 1 ADS*EEEGAVELAA 0.14 0.043
Gorasp1 O35254 S376 Golgi reassembly-stacking protein 1 GGEATWSGSEFEISFPDS*PGSQ#AQVDHLPR 0.14 0.043
Phyhipl Q6AYN4 S14;S15 Phytanoyl-CoA hydroxylase-interacting protein-like LDHALSSPS*S*PC^EEIK 0.14 0.044
Mycbpap Q69CM7 S865 MYCBP-associated protein LLS*EDPPADSSATSQEPIDPLVMEK 0.14 0.045
Ndrg3 Q6AYR2 S331;S333 Protein NDRG3 THS*TS*SSIGSGESPFSR 0.14 0.046
Ralgapa2 P86411 S819 Ral GTPase-activating protein subunit alpha-2 SS*SPAELDLK 0.14 0.046
Map2 P15146 S1816;S1820;S1824 Microtubule-associated protein 2 VDHGAEIITQS*PSRS*SVAS*PR 0.14 0.047
Pard3 Q9Z340 T947 Partitioning defective 3 homolog SYDKPMVDDDDEGM@ET*LEEDTEESSR 0.14 0.049
Aak1 P0C1X8 S625 AP2-associated protein kinase 1 VGSLTPPSS*PK 0.14 0.049
Epb41l1 Q9WTP0 S437 Band 4.1-like protein 1 SLDGAEFS*RPAS?VSENHDAGPDGDKREDDAESGGR 0.14 0.05
Slc16a1 P53987 S492 Monocarboxylate transporter 1 ETQSPAPLQNSSGDPAEEES*PV 0.14 0.05
Git1 Q9Z272 S394;S397 ARF GTPase-activating protein GIT1 N#QSDLDDQHDYDS*VAS*DEDTDQEPLPSAGATR 0.14 0.051
Stat5a Q62771 S128 Signal transducer and activator of transcription 5A EAN#NC^SS*PAGVLVDAMSQK 0.14 0.054
Brd2 Q6MGA9 S319 Bromodomain-containing protein 2 RES*GRPIKPPR 0.14 0.054
Slc4a4 Q9JI66 S1034 Electrogenic sodium bicarbonate cotransporter 1 KGSLDSDN#DDS*DC^PYSEK 0.14 0.054
Lmna P48679 S404;S409 Prelamin-A/C ASS*HS?SQS*QGGGSVTK 0.14 0.054
Rab11fip1 Q3B7T9 S343;S347 Rab11 family-interacting protein 1 ESS*PSNS*PSPQGFR 0.14 0.055
Camk1 Q63450 S324 Calcium/calmodulin-dependent protein kinase type 1 LQLGTS*QEGQGQTASHGELLTPTAGGPAAGC^C^C^R 0.14 0.055
Eif5 Q07205 S387;S388 Eukaryotic translation initiation factor 5 EAEEES*S*GGEEEDEDEN#IEVVYSK 0.14 0.056
Afdn O35889 S561;S564;S565 Afadin LDSDRVS*SAS*S*TAER 0.14 0.058
Pak2 Q64303 S165 Serine/threonine-protein kinase PAK 2 GSETS*AVVTEEDDDDEDAAPPVIAPRPDHTK 0.14 0.058
Chd6 D3ZA12 S36 Chromodomain-helicase-DNA-binding protein 6 SPS*PFDC^SPDQ#GENIEEAANHC^LPQK 0.14 0.058
Itpr2 P29995 S1160 Inositol 1,4,5-trisphosphate receptor type 2 GGEEANEESNLLS*PVQDGAK 0.14 0.059
Synj1 Q62910 S1049 Synaptojanin-1 TS*PC^QSPTAPEYSAPSLPIRPSR 0.14 0.06
Atp1a1 P06685 S722 Sodium/potassium-transporting ATPase subunit alpha-1 QGAIVAVTGDGVNDS*PALKK 0.14 0.06
Cep95 Q5XI03 S299 Centrosomal protein of 95 kDa APS*VEPGDVFLTSTLC^K 0.14 0.06
Aebp1 A2RUV9 S168;T169 Adipocyte enhancer-binding protein 1 RFS*T*VAPLETPER 0.14 0.061
Leo1 Q641X2 S619;S622;S626 RNA polymerase-associated protein LEO1 IYS*SDS*DEGS*EEDKAQR 0.14 0.061
Parg Q9QYM2 S135 Poly(ADP-ribose) glycohydrolase LGNVPQLNLDKS*PTEK 0.14 0.062
Srfbp1 Q66H19 S260;S277 Serum response factor-binding protein 1 TTEDSVC^EPDDNS*ISKEEVSEEEKEYFDDS*TEER 0.14 0.063
Slc4a7 Q9R1N3 S314 Sodium bicarbonate cotransporter 3 C^TTPVPTPQNS*PPS?SPSLSR 0.14 0.063
Cast P27321 S281 Calpastatin N#EAITGPLPDSPKPMGIDHAIDALSSDFTC^S?S*PTGK 0.14 0.065
Hbp1 Q62661 S378 HMG box-containing protein 1 AS*LSC^GGPGTGQEFAGSEFSK 0.14 0.066
Ist1 Q568Z6 T280 IST1 homolog GPSDFSGLPVGTYQ#AFPNIHPPQ#IPAT*PPSYESVDDINADK 0.14 0.067
Safb O88453 S405 Scaffold attachment factor B1 MS*SVEDDSDTK 0.14 0.068
Smarcad1 D3Z9Z9 S137 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 DTVIIVSEPSEDEESHDLPS*ATR 0.14 0.068
Kidins220 Q9EQG6 S1644 Kinase D-interacting substrate of 220 kDa KS*PSEC^SLIASSPEESWPAC^QK 0.14 0.069
Ubr4 Q2TL32 S178;S181 E3 ubiquitin-protein ligase UBR4 ELAS*PVS*PELR 0.14 0.071
Tbx3 Q7TST9 S371;S375 T-box transcription factor TBX3 DLC^PS*EAES*DAEAESK 0.14 0.071
Prpf4b Q5RKH1 S578;S580 Serine/threonine-protein kinase PRP4 homolog S*PS*PDDILER 0.14 0.071
Limk2 P53670 S289;S293;S298 LIM domain kinase 2 SNS*ISKS*PGPSS*PKEPLLLSR 0.14 0.072
Cdc5l O08837 T430;T442 Cell division cycle 5-like protein SGTT*PKPVT?NATPGRT*PLR 0.14 0.073
Psen1 P97887 S368;T371;S372 Presenilin-1 AAVQELSGS*ILT*S*EDPEER 0.14 0.073
Nap1l1 Q9Z2G8 S10 Nucleosome assembly protein 1-like 1 EQS*ELDQDLEDVEEVEEEETGEETK 0.14 0.074
Camk2d P15791 T370;T371 Calcium/calmodulin-dependent protein kinase type II subunit delta ESTESSNT*T*IEDEDVK 0.14 0.075
Slc9a1 P26431 T755 Sodium/hydrogen exchanger 1 TT*PEEEEEDEDGVIM@IR 0.14 0.076
Dusp4 Q62767 S316 Dual specificity protein phosphatase 4 QRRS*IIS?PN#FSFMGQLLQFESQVLTTSC^AAEAASPSGPLR 0.14 0.076
Cast P27321 S122 Calpastatin S*NEQIVSEK 0.14 0.077
Tpr F1MA98 S379 Nucleoprotein TPR GAILSEEELAAM@S*PTAAAVAK 0.14 0.077
Kazn Q5FWS6 S372 Kazrin SLHNPIVQS*LEDLEDQK 0.14 0.078
Arhgef11 Q9ES67 T676;T680 Rho guanine nucleotide exchange factor 11 SLENPT*PPFT*PK 0.14 0.078
Tbx3 Q7TST9 S703;S707 T-box transcription factor TBX3 SSTLSSGS*VSLS*PK 0.14 0.08
Kif1b O88658 T647 Kinesin-like protein KIF1B EKT*PSAETPSEPVDWTFAQR 0.14 0.08
Cr1l Q63135 T556 Complement component receptor 1-like protein EDSC^VQPQSLLTSQ#ENNSTSSPARNSLT*Q#EV 0.14 0.081
Tmpo Q62733 T354 Lamina-associated polypeptide 2, isoform beta EMFPYEAST*PTGISASC^R 0.14 0.083
Sgpl1 Q8CHN6 S564 Sphingosine-1-phosphate lyase 1 M@VAEISSVFLDSLYSTDPVTQ#GNQMN#GS*PKPR 0.14 0.086
Slc9a1 P26431 S727;S730 Sodium/hydrogen exchanger 1 ADLPVITIDPAS*PQS*PESVDLVNEELK 0.14 0.087
Lrrfip1 Q66HF9 S675 Leucine-rich repeat flightless-interacting protein 1 DAS*QIGGEEGLVPSQHPGQADEK 0.14 0.087
Ralgapa1 O55007 S379;S380;S385 Ral GTPase-activating protein subunit alpha-1 EPS*S*S?SLC^S*IDEEHLTDIEIVR 0.14 0.088
Sorbs2 O35413 S1100;S1113 Sorbin and SH3 domain-containing protein 2 NTKGS*EDYPDPPLPHSYS*SDR 0.14 0.088
Crtc2 Q3LRZ1 S433 CREB-regulated transcription coactivator 2 VPLS*PLSLPAGPADAR 0.14 0.088
Synrg Q9JKC9 S1021;T1031 Synergin gamma SQENTC^PS*PASSVASHET*PK 0.14 0.088
Ilf3 Q9JIL3 S73 Interleukin enhancer-binding factor 3 GNSELSEAEN#MDTPPDDES*KEGAGEQK 0.14 0.09
Pgm1 P38652 T115 Phosphoglucomutase-1 AIGGIILT*ASHNPGGPN#GDFGIK 0.14 0.09
Prpf4b Q5RKH1 S88;S94 Serine/threonine-protein kinase PRP4 homolog EVLDAS*DKEGLS*PAKR 0.14 0.091
Araf P14056 T181;S186 Serine/threonine-protein kinase A-Raf QQEVPSNLSVN#ELLT*PQGPS*PFTQQR 0.14 0.092
Znf652 A1L1J6 T103 Zinc finger protein 652 EDRENSDDT*EEEEEVSYK 0.14 0.094
Rabep2 Q62835 S176;S180;S187 Rab GTPase-binding effector protein 2 QPAS*LHGS*TELLPLS*R 0.14 0.095
Dnmt3a Q1LZ53 T256;T257 DNA (cytosine-5)-methyltransferase 3A VEEASPPAVQQPTDPASPTVAT*T*PEPVGADAGDK 0.14 0.096
Srek1ip1 Q5RJP9 S52 Protein SREK1IP1 RDIVLDVSSTSSEDS*DEESEELNK 0.14 0.098
Als2 P0C5Y8 S460 Alsin SSS*LMDIR 0.14 0.101
Leo1 Q641X2 S619;S620;S622;S626 RNA polymerase-associated protein LEO1 IYS*S*DS*DEGS*EEDKAQR 0.14 0.102
Gphn Q03555 S201;S207 Gephyrin EVHDELEDLPS*PPPPLS*PPPTTSPHK 0.14 0.103
Syt1 P21707 T128 Synaptotagmin-1 DQALKDDDAETGLT*DGEEKEEPK 0.14 0.103
Pds5b Q6TRW4 S1257 Sister chromatid cohesion protein PDS5 homolog B GHAAS*ESEEQQWPEEK 0.14 0.104
Lsr Q9WU74 T396;S407;S410 Lipolysis-stimulated lipoprotein receptor APALT*PIRDEEWN#RHS*PQS*PR 0.14 0.105
Mt2 P04355 S14 Metallothionein-2 M$DPNC^SC^ATDGSC^S*C^AGSC^K 0.14 0.106
Ndrg2 Q8VBU2 T20 Protein NDRG2 A$ELQEVQITEEKPLLPGQT*PEAAK 0.14 0.107
Eef1d Q68FR9 T147;S162 Elongation factor 1-delta GAT*PAEDDEDNDIDLFGS*DEEEEDKEAAR 0.14 0.111
Dlgap1 P97836 S362;S365;T367;S372 Disks large-associated protein 1 AMGDEDS*GDS*DT*SPKPS*PK 0.14 0.112
Prpf4b Q5RKH1 S569 Serine/threonine-protein kinase PRP4 homolog YLAEDSNISVPSEPSS*PQSSTR 0.14 0.112
Tcf12 P51514 S98 Transcription factor 12 LGTHEGLS*PTPFMNSNLIGK 0.14 0.112
Adgrl2 O88923 S1428 Adhesion G protein-coupled receptor L2 S*ENEDIYYK 0.14 0.114
Rtn4 Q9JK11 S329 Reticulon-4 EDLVC^SAALHS*PQESPVGK 0.14 0.116
Rtkn Q6V7V2 S504 Rhotekin TFS*LDAVPADHSLGPSR 0.14 0.117
Arfgap1 Q62848 S360 ADP-ribosylation factor GTPase-activating protein 1 SS*DSWDIWGSGSASN#NK 0.14 0.117
Rplp1 P19944 S101;S104 60S acidic ribosomal protein P1 KEES*EES*EDDM@GFGLFD 0.14 0.118
Als2 P0C5Y8 S477;S486 Alsin RLS*LPGLLSQVS*PR 0.14 0.119
Psip1 Q812D1 T271;S274 PC4 and SFRS1-interacting protein NLAKPGVTST*SDS*EEDDDQEGEK 0.14 0.119
Nono Q5FVM4 T415 Non-POU domain-containing octamer-binding protein GAMPPAPVPPGT*PAPPGPAAMMPDGTLGLTPPTTER 0.14 0.119
Crem Q03061 S290 cAMP-responsive element modulator APTTALPQGVVMAASPGSLHS*PQ#QLAEEATR 0.14 0.12
Piezo1 Q0KL00 S543 Piezo-type mechanosensitive ion channel component 1 APS*TLLEVTVSDTEPTQTQTLLR 0.14 0.121
Myo9b Q63358 T1898 Unconventional myosin-IXb T?KSPRT*PVVQ#DLEELGALPEEAAGGDEDR 0.14 0.122
Thrb P18113 Y395 Thyroid hormone receptor beta Y*Q#DSFLLAFEHYINYR 0.14 0.125
Golph3l Q66H74 S32 Golgi phosphoprotein 3-like KIESEEDTNQERS*PDNEDPGDSK 0.14 0.125
Vcpip1 Q8CF97 T760;S767 Deubiquitinating protein VCIP135 DGPS?SAPAT*PTKAPYS*PTTSK 0.14 0.13
Bcl10 Q9QYN5 S138;S141;S144 B-cell lymphoma/leukemia 10 SNS*DES*NFS*EK 0.14 0.131
Ptk2b P70600 S778 Protein-tyrosine kinase 2-beta HS*MREEDFIRPSSR 0.14 0.131
Arhgap17 Q99N37 S520 Rho GTPase-activating protein 17 HIS*PAFQPPLPPTDGNALAPAGPELPSQSSR 0.14 0.133
Gorab B1H222 S335 RAB6-interacting golgin LSQPDGEGVSSELTEENKEPQKPATS*PETDK 0.14 0.135
Copg1 Q4AEF8 T594 Coatomer subunit gamma-1 SVPLATTPM@TEQ#RPEST*STAAVK 0.14 0.135
Sh3rf1 Q71F54 S700 E3 ubiquitin-protein ligase SH3RF1 TVTILPGLPTS*PESAASAC^GNSSAVKPDK 0.14 0.137
Kat5 Q99MK2 S199;S202 Histone acetyltransferase KAT5 SNC^LGTDEDS*QDS*SDGIPSAPR 0.14 0.138
Git1 Q9Z272 S601 ARF GTPase-activating protein GIT1 HGS*GAESDYEN#TQSGEPLLGLEGK 0.14 0.138
Washc2 Q80X08 S780 WASH complex subunit 2 EGLLPTSDQ#EAGGPSDIFSSSS*PLDK 0.14 0.139
Fam110b Q5BJX5 S234 Protein FAM110B S*PDADQVEPAC^GVSR 0.14 0.14
Bsnd Q8R2H3 S202;S206 Barttin S*PQPS*PPDRDEAHLQVPWASR 0.14 0.142
Ddx21 Q3B8Q1 S9;S11;S13 Nucleolar RNA helicase 2 SAS*KS*ES*EGTEESM@ETLQKPSEK 0.14 0.142
Dap Q9QX67 S49 Death-associated protein 1 KDKDDQEWES*TSPPKPTVYISGVIAR 0.14 0.145
Dclre1c Q5XIX3 T661 Protein artemis TSLTSTQADSQ#SSSDFEIPST*PEAELPKPEHLQFLYGK 0.14 0.146
Lzts3 Q8K1Q4 S700 Leucine zipper putative tumor suppressor 3 IES*TEI 0.14 0.147
Arfgef2 Q7TSU1 S621 Brefeldin A-inhibited guanine nucleotide-exchange protein 2 C^S*VTSVESTVSSGTQTAIPDDPEQFEVIK 0.14 0.147
Washc2 Q80X08 S1130 WASH complex subunit 2 STGS*QSMEGASVK 0.14 0.149
Map4k3 Q924I2 S433 Mitogen-activated protein kinase kinase kinase kinase 3 SISIPQDTHSSEDS*NQGTIK 0.14 0.149
Afap1l1 D4AB98 S87;S93;S97 Actin filament-associated protein 1-like 1 DMS*DDGERS*KEAS*PEPIK 0.14 0.152
Ston2 D4AB66 S413 Stonin-2 QLQIDDPDPVGN#AALPDDDPTASVEPDAPS*PTSALSQPR 0.14 0.157
Golim4 Q5BJK8 S328 Golgi integral membrane protein 4 ALEEEEMEQVGQ#AEHLEEEHDPS*PEEQDR 0.14 0.158
Tmem55a Q4V888 S10;S14;T22;S33 Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase S*PLLS*ASHSGNVT*PTAPPYLQESS*PR 0.14 0.158
Zc3h18 Q6TQE1 S63;S70;S74 Zinc finger CCCH domain-containing protein 18 VQSQEEIHS*DEEDQAS*EPKS*QDQDSEAHELSR 0.14 0.16
Crebbp Q6JHU9 T975;S977 CREB-binding protein VPT*PS*SVTS?AETSSQQPGPDVPMLEMK 0.14 0.16
Mpdz O55164 S1443 Multiple PDZ domain protein NADAVNQMAVC^PGSAADPLPSTSES*PQNK 0.14 0.169
Iws1 Q3SWT4 S277;S280;S289 Protein IWS1 homolog EKPES*EDS*DGENKREDS*EVQNESDGHADR 0.14 0.176
Tfip11 Q5U2Y6 S210 Tuftelin-interacting protein 11 TTQSLQDFPVADS*EEEAEEEFQ#K 0.14 0.178
Evl O08719 S302;S304 Ena/VASP-like protein KEDENQTEDPSTS*PS*PGSR 0.14 0.179
Slc4a2 P23347 S10;S14 Anion exchange protein 2 RPAS*GADS*LHTPEPESLSPGTPGFPEQ#EEEDELR 0.14 0.183
Lsr Q9WU74 S379 Lipolysis-stimulated lipoprotein receptor AM@SEVTS*LHEDDWR 0.14 0.184
Gsk3b P18266 S9 Glycogen synthase kinase-3 beta TTS*FAESC^KPVQQPSAFGSM@K 0.14 0.188
Taf11 Q5U1X0 S48 Transcription initiation factor TFIID subunit 11 ATPGAPVSADTEGIPEETDQVGDADS*KEAAAEESELK 0.14 0.188
Sgta O70593 S302;S306 Small glutamine-rich tetratricopeptide repeat-containing protein alpha S*RTPS*ASHEEQQE 0.14 0.192
Arhgef11 Q9ES67 T1521;S1524 Rho guanine nucleotide exchange factor 11 EALASDSQN#GQ#EQ#GSC^PEEGSDIALEDSATDT*AVS*PGP 0.14 0.193
Fam129b B4F7E8 S626;S641;S645 Niban-like protein 1 QVVS*VVQDEESGLPFEAGS*EPPS*PASPDNVTELR 0.14 0.198
Cds2 Q91XU8 S20;S32 Phosphatidate cytidylyltransferase 2 EDAPPEDKES*ESEAKLDGETAS*DSESR 0.14 0.2
Pdha1 P26284 S293 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial YHGHS*M@SDPGVSYR 0.14 0.202
Nudt4 Q99MY2 S147 Diphosphoinositol polyphosphate phosphohydrolase 2 LGC^S*PTN#GN#STVPSLPDNNALFVTAAPPSGVPSSIR 0.14 0.204
Thrap3 Q5M7V8 S182 Thyroid hormone receptor-associated protein 3 KS*S?SKDSRPSQAAGDNQGDEAK 0.14 0.209
Iws1 Q3SWT4 S383;S394;S395 Protein IWS1 homolog TVAS*DSEEEVGKEES*S*VKK 0.14 0.212
Epn3 Q4V882 S430 Epsin-3 GKSPSPVELDPFGDSS*PSC^K 0.14 0.218
Nr2c1 Q8VIJ4 S334 Nuclear receptor subfamily 2 group C member 1 ALTPGENPAC^QSPGES*MEGSTHLIAGEPSC^MER 0.14 0.232
Sipa1l1 O35412 S255 Signal-induced proliferation-associated 1-like protein 1 GS*GFSLDVIDGPISQR 0.14 0.235
Nasp Q66HD3 T465;S468 Nuclear autoantigenic sperm protein EGEET*EGS*EEEDKENDKAEETTNESVLEK 0.14 0.243
Hp1bp3 Q6P747 S70;S71 Heterochromatin protein 1-binding protein 3 LAEGEEEKPEPDGS*S*EES?ISTVEEPENETPPAPSR 0.14 0.244
Srsf5 Q09167 S245;S247 Serine/arginine-rich splicing factor 5 S*KS*PASVDR 0.14 0.245
Git1 Q9Z272 S601;S605 ARF GTPase-activating protein GIT1 HGS*GAES*DYENTQSGEPLLGLEGK 0.14 0.245
Parva Q9HB97 S8;S10 Alpha-parvin S*PS*VPKSPTPK 0.14 0.249
Iws1 Q3SWT4 S277;S280;S289;S295 Protein IWS1 homolog EKPES*EDS*DGENKREDS*EVQNES*DGHADR 0.14 0.278
Slc12a1 P55016 S116 Solute carrier family 12 member 1 NTGS*VSGPK 0.14 0.287
Ppp1r12a Q10728 S507 Protein phosphatase 1 regulatory subunit 12A LGS*TSDIEEK 0.14 0.289
Pcnp Q7TP40 S48 PEST proteolytic signal-containing nuclear protein TVS*SSN#GGESSSR 0.14 0.299
Itpkb P42335 S189 Inositol-trisphosphate 3-kinase B SSS*QPPER 0.14 0.307
Ptk2 O35346 T575 #REF! YM@EDST*Y?YK 0.14 0.339
Vps4a Q793F9 S90;S95;S97 Vacuolar protein sorting-associated protein 4A ENQ#S*EGKGS*DS*DSEGDNPEK 0.13 9.01E-04
Srek1 Q9JKL7 S457 Splicing regulatory glutamine/lysine-rich protein 1 EADSTVS*TDADEKDTAR 0.13 0.001
Akt3 Q63484 S34 RAC-gamma serine/threonine-protein kinase TDGS*FIGYK 0.13 0.001
Palm Q920Q0 T362;S365 Paralemmin-1 EENQTGPTT*TPS*DTQDLDMK 0.13 0.004
Rbmx2 B0BN49 T140;S144;S149 RNA-binding motif protein, X-linked 2 T*PPSS*PPEVS*EDEDAK 0.13 0.005
Ubr4 Q2TL32 S619 E3 ubiquitin-protein ligase UBR4 AAPPPPPPPPPLES*SPR 0.13 0.006
Qki Q91XU1 S69 Protein quaking RS*AELPDAVGPIVQLQEK 0.13 0.006
Ostf1 Q6P686 S202 Osteoclast-stimulating factor 1 TLS*NAEDYLDDEDSD 0.13 0.007
Sptbn2 Q9QWN8 T2144 Spectrin beta chain, non-erythrocytic 2 LPPSTQAPSIN#GVC^T*DTESSQPLLEQQR 0.13 0.007
Nes P21263 S620 Nestin TEDQELM@S*PK 0.13 0.008
Thop1 P24155 S16 Thimet oligopeptidase MKPPAAC^AGDVVDTVS*PC^STVNHLR 0.13 0.009
Mme P07861 S6 Neprilysin SES*QMDITDINAPKPK 0.13 0.012
Trio F1M0Z1 S2283 Triple functional domain protein NFLNALTS*PIEYQR 0.13 0.013
Prrc2a Q6MG48 S1307;S1326 Protein PRRC2A TAAKS*PDLSNQN#SDQANEEWETAS*ESSDFASER 0.13 0.013
Arhgap24 Q5U2Z7 S391;S402 Rho GTPase-activating protein 24 SSMDN#GS*PTALSGS?KTNS*PR 0.13 0.015
Rsrc1 Q5PPJ2 S331 Serine/Arginine-related protein 53 LMGS*PVA 0.13 0.015
Sarg Q499V8 S79;S82 Specifically androgen-regulated gene protein TIGSLEAEADSGLSTDESEPATS*PQS*FR 0.13 0.017
Aqp4 P47863 S21 Aquaporin-4 ES*IMVAFK 0.13 0.018
Dab2ip Q6P730 S915 Disabled homolog 2-interacting protein LMS*VEEELKK 0.13 0.021
Zdhhc5 Q2THW7 T659 Palmitoyltransferase ZDHHC5 APSGVSETEEVALQPLLT*PK 0.13 0.024
Aqp4 P47863 S316 Aquaporin-4 DSS*GEVLSSV 0.13 0.025
Thrap3 Q5M7V8 T870 Thyroid hormone receptor-associated protein 3 EEEWDPEYT*PK 0.13 0.026
Prdx6 O35244 T44 Peroxiredoxin-6 DFT*PVC^TTELGR 0.13 0.027
Tmub1 Q53AQ4 T93;S97 Transmembrane and ubiquitin-like domain-containing protein 1 GPSAQPEPEAGVTAST*PPDS*PQEPLLLR 0.13 0.027
Hdgfl3 Q923W4 T117;S121 Hepatoma-derived growth factor-related protein 3 FTGYQTIQQQSSSETEGEGGN#T*ADAS*SEEEGDRVEDGK 0.13 0.028
Hp1bp3 Q6P747 S247 Heterochromatin protein 1-binding protein 3 KGS*AVDPEPQVK 0.13 0.031
Srek1 Q9JKL7 S489 Splicing regulatory glutamine/lysine-rich protein 1 LC^S*TADAV 0.13 0.032
Ddx21 Q3B8Q1 S11 Nucleolar RNA helicase 2 SASKS*ESEGTEESMETLQ#KPSEK 0.13 0.033
Tpr F1MA98 T650 Nucleoprotein TPR SSTSQT*VSTPAPEPIIESTETIEAK 0.13 0.035
Psip1 Q812D1 S274 PC4 and SFRS1-interacting protein N#LAKPGVTSTS?DS*EEDDDQEGEK 0.13 0.035
Hmgn5 B4F777 S236 High mobility group nucleosome-binding domain-containing protein 5 KES*QHEEEGKEELHEEDGK 0.13 0.036
Rabep1 O35550 S162 Rab GTPase-binding effector protein 1 RLS*EGQEEENLENEMK 0.13 0.036
Ncam1 P13596 T813 Neural cell adhesion molecule 1 HTEPNETT*PLTEPEKGPVETK 0.13 0.037
Tle4 Q07141 S220;S225;S240 Transducin-like enhancer protein 4 YDS*DGEKS*DDNLVVDVSNEDPSS*PR 0.13 0.039
Rasl11a Q6IMA3 S217 Ras-like protein family member 11A S*PNMQDLK 0.13 0.042
Sugp1 Q68FU8 S337 SURP and G-patch domain-containing protein 1 S*APEALSGAVPPITAC^PTPVAPAPAVNPTPSIPGKPTATATVK 0.13 0.042
Washc2 Q80X08 S720 WASH complex subunit 2 VPLLFS*DEEDSEVPSGVKPVDLK 0.13 0.043
Tanc1 Q6F6B3 S204 Protein TANC1 S*PC^ETISSPSSTLESK 0.13 0.044
Vcpip1 Q8CF97 S1197 Deubiquitinating protein VCIP135 AQKEN#S*MEEPEEMDSQDAETTN#TTEPMDHS 0.13 0.044
Cmtr1 Q5U2Z5 S27;T29 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 HLS*ST*SDDEPLSSVSHAAK 0.13 0.046
Zc3h18 Q6TQE1 S63;S70 Zinc finger CCCH domain-containing protein 18 VQSQEEIHS*DEEDQAS*EPK 0.13 0.047
Mgea5 Q8VIJ5 S505 Protein O-GlcNAcase MAEELKPMDTDKES*IAESK 0.13 0.047
Aatf Q9QYW0 S280;S284;S285 Protein AATF GTKPNAES*EEIS*S*EDDELVGEK 0.13 0.047
Cobl D3ZUI5 S256 Protein cordon-bleu AEHLGLSGADS*DEDPSK 0.13 0.049
Sipa1l1 O35412 S318 Signal-induced proliferation-associated 1-like protein 1 SSDLEDNRS*EDSVRPWTC^PK 0.13 0.05
Ssx2ip Q8CGZ2 S313 Afadin- and alpha-actinin-binding protein AEDSTGTVVIS*DVEDDAGELSR 0.13 0.05
Casp8 Q9JHX4 T189 Caspase-8 RM@ST*EGGEELPVSVLDEVTIK 0.13 0.05
Nbn Q9JIL9 S533 Nibrin ASNASSVGGIDIKPN#GKS*PDSK 0.13 0.051
Shank3 Q9JLU4 T1235;S1254 SH3 and multiple ankyrin repeat domains protein 3 LGAEEERPGT*PELAPTPMQAAAVAEPMPS*PR 0.13 0.053
Rtn4 Q9JK11 S16 Reticulon-4 E$DIDQSSLVSSSTDS*PPRPPPAFK 0.13 0.053
Ttgn1 P19814 S234;T251 Trans-Golgi network integral membrane protein TGN38 GDKS*SEPTEDVETKEIEEGDT*EPEEGSPLEEEN#EK 0.13 0.055
Arhgap27 Q6TLK4 T535 Rho GTPase-activating protein 27 LST*PEYTVELR 0.13 0.056
Mtmr3 Q5PQT2 S652 Myotubularin-related protein 3 SLELSSFAGS*GEEVPAIDSLR 0.13 0.058
Rnpc3 Q4G055 S349;T352 RNA-binding protein 40 NSDS*PDT*GLDDSNTGFGK 0.13 0.059
Insr P15127 S1348 Insulin receptor EGGS*SLSIK 0.13 0.063
Jun P17325 S63 Transcription factor AP-1 NSDLLTS*PDVGLLK 0.13 0.064
Skap2 Q920G0 S6 Src kinase-associated phosphoprotein 2 PNPGS*TSSPGSIPEEIR 0.13 0.065
Slc6a12 P48056 T598 Sodium- and chloride-dependent betaine transporter SPQDGSSAQNC^ST*SPVKQELIAWEK 0.13 0.065
Gtpbp1 D2XV59 S69 GTP-binding protein 1 LVLVS*PTSEQYDSLLR 0.13 0.066
Snapc2 Q68FX5 S320 snRNA-activating protein complex subunit 2 RPRPGTEDGGTDSTGPEETGQGS*PQASEPTEPR 0.13 0.066
Afdn O35889 S1779 Afadin S*QDADLPGSSGAPENLTFR 0.13 0.066
Pick1 Q9EP80 T379 PRKCA-binding protein DADVFPIEVDLAHTTLAYGPNQ#GGFT*DGEDEEEEEEDGAAR 0.13 0.068
Ddx21 Q3B8Q1 S11;S13 Nucleolar RNA helicase 2 SASKS*ES*EGTEESMETLQKPSEK 0.13 0.068
Gramd2b Q5FVG8 S19;S20 GRAM domain-containing protein 2B KPISS?SDEVFKFEIPS*S*PK 0.13 0.068
Cmpk1 Q4KM73 S180 UMP-CMP kinase S*VDEVFGDVMK 0.13 0.069
Itpr1 P29994 S2688 Inositol 1,4,5-trisphosphate receptor type 1 AMSLVSSDS*EGEQNELR 0.13 0.071
Ptk2b P70600 S375 Protein-tyrosine kinase 2-beta NS*LPQIPTLNLESR 0.13 0.074
Gramd2b Q5FVG8 S234;S238 GRAM domain-containing protein 3 SIC^GHLENTS*VGNS*PNPSSAEN#SFR 0.13 0.077
Hdgfl2 Q925G1 S231;S233;S235;S239 Hepatoma-derived growth factor-related protein 2 KVPSAS*DS*DS*RADS*DGAK 0.13 0.081
Eef1a1 P62630 S396 Elongation factor 1-alpha 1 S*GDAAIVDMVPGKPMC^VESFSDYPPLGR 0.13 0.082
Cfap36 Q4V8E4 S85 Cilia- and flagella-associated protein 36 EIGINEDQFQEAC^TS*PLAK 0.13 0.083
Eef1a1 P62630 S222 Elongation factor 1-alpha 1 KDGS*ASGTTLLEALDC^ILPPTRPTDKPLR 0.13 0.084
Dnmt1 Q9Z330 S718 DNA (cytosine-5)-methyltransferase 1 EADEDEEADDDIPELPS*PK 0.13 0.084
Znf148 Q62806 S301 Zinc finger protein 148 GGLLTSEEDS*GFSTSPK 0.13 0.084
Palmd Q4KM62 S520 Palmdelphin HS*PLGVPGAGDGTEDPSLTALR 0.13 0.086
Gtf2i Q5U2Y1 S812 General transcription factor II-I KTNSS*PSVN#TTASGVEDLNIIQVTIPDDDNER 0.13 0.088
Kidins220 Q9EQG6 S1351;S1353 Kinase D-interacting substrate of 220 kDa TPS*LS*SLNSQDSSIEISK 0.13 0.088
Eif4ebp1 Q62622 T45 Eukaryotic translation initiation factor 4E-binding protein 1 VALGDGVQLPPGDYST?T?PGGTLFSTT*PGGTR 0.13 0.09
Ppp1r2 P50411 S121;S122;S130 Protein phosphatase inhibitor 2 EQES*S*GEEDN#DLS*PEER 0.13 0.091
Zc3h18 Q6TQE1 S91;S112 Zinc finger CCCH domain-containing protein 18 GPAGS*PC^EEGDDAEEDGTS?DLRDEAS*SVTR 0.13 0.091
Pcyt1a P19836 S343;S345;S350 Choline-phosphate cytidylyltransferase A TS*PS*SSPAS*LSR 0.13 0.092
Atp7a P70705 S1439 Copper-transporting ATPase 1 SPS?EISVHVGIDDTSRNS*PR 0.13 0.092
Arhgap17 Q99N37 T752 Rho GTPase-activating protein 17 LGEQGPEPGPTPPQTPTPPST*PPPAK 0.13 0.095
Krt19 Q63279 S54 Keratin, type I cytoskeletal 19 IVS*SSSGGYVGGR 0.13 0.095
Fam129b B4F7E8 S626;S641;S645;S648 Niban-like protein 1 QVVS*VVQDEESGLPFEAGS*EPPS*PAS*PDNVTELR 0.13 0.096
Synrg Q9JKC9 S567 Synergin gamma SGS*IDDSFTDFQEVPASSK 0.13 0.096
Mprip Q9ERE6 S224;S226;S230 Myosin phosphatase Rho-interacting protein AKDQPDGTS*LS*PVQS*PSQSQPPAAC^TPR 0.13 0.1
Elk1 A4GTP4 S265 ETS domain-containing protein Elk-1 EELEVTEVGGFS*PEAVK 0.13 0.105
Limk1 P53669 S298 LIM domain kinase 1 SC^S*IDTSPGAGSLVSPASQR 0.13 0.105
Krt18 Q5BJY9 S31;S32 Keratin, type I cytoskeletal 18 VRPAS*S*AASVYAGAGGSGSR 0.13 0.105
Ahsg P24090 S324 Alpha-2-HS-glycoprotein HAFSPVASVESASGEVLHS*PK 0.13 0.106
Pxn Q66H76 S83;S85 Paxillin YAHQQPPS*PS*PIYSSSTK 0.13 0.109
Shroom2 Q7TP36 S806 Protein Shroom2 YHS*ADDILDAGLDQ#QQRPQYIHER 0.13 0.109
Cdk17 O35831 S92 Cyclin-dependent kinase 17 N#GS*RLDIVHENLK 0.13 0.109
Rtn4 Q9JK11 S169;S171 Reticulon-4 RGS*GS*VDETLFALPAASEPVIPSSAEK 0.13 0.112
Map4 Q5M7W5 S902 Microtubule-associated protein 4 LATTVS*APDLK 0.13 0.112
Dvl1 Q9WVB9 T674 Segment polarity protein dishevelled homolog DVL-1 ELAAVPPELT*GS?RQSFQK 0.13 0.113
Arfgef2 Q7TSU1 S621;T623 Brefeldin A-inhibited guanine nucleotide-exchange protein 2 RC^S*VT*SVES?TVSSGTQTAIPDDPEQFEVIK 0.13 0.114
Ppp1r2 P50411 S121;S122 Protein phosphatase inhibitor 2 EQ#ES*S*GEEDN#DLSPEER 0.13 0.114
Arhgef2 Q5FVC2 S142 Rho guanine nucleotide exchange factor 2 GLS*SLSLAK 0.13 0.115
Cdk18 O35832 S420 Cyclin-dependent kinase 18 VHQLDDTASIFS*LK 0.13 0.117
Agtrap Q642A2 S141 Type-1 angiotensin II receptor-associated protein SDFFGPSQEHSAYQTIDSSDS*PADPLASLENK 0.13 0.119
Ralgapb P86410 S710 Ral GTPase-activating protein subunit beta TNS*GISSASGGSTEPTT?PDSERPAQALLR 0.13 0.122
Mum1 B1H224 S260 PWWP domain-containing protein MUM1 GDSVAESGGQASSC^VALAS*PR 0.13 0.124
Htt P51111 S1845 Huntingtin SLNPQIS*AEEDSGSAAQLGM@C^NR 0.13 0.124
Tada2a Q6AYE3 S6 Transcriptional adapter 2-alpha LGS*FSN#DPSDKPPC^R 0.13 0.129
Strn P70483 Y135 Striatin YGTELNQGDMKPPSY*DSDEGNETEVQPQQNSQFM@WK 0.13 0.13
Npm1 P13084 S125 Nucleophosmin C^GSGPVHISGQ#HLVAVEEDAES*EDEDEEDVK 0.13 0.132
Kidins220 Q9EQG6 S1351;S1353;S1357 Kinase D-interacting substrate of 220 kDa TPS*LS*SLNS*QDSSIEISK 0.13 0.134
Kat6a Q5TKR9 S1248;S1255 Histone acetyltransferase KAT6A AMS*PLDSSNS*PDADPKEPEAEEEEEKPLDDPR 0.13 0.135
Thrap3 Q5M7V8 S619 Thyroid hormone receptor-associated protein 3 S*PSELFAQHIVTIVHHVK 0.13 0.135
Csf1 Q8JZQ0 S545;S552;S553 Macrophage colony-stimulating factor 1 TLDSS*VGRPEGS*S*LAQDEDR 0.13 0.135
Sorbs1 P84109 S15 Sorbin and SH3 domain-containing protein 1 (Fragments) YS*FSEDTK 0.13 0.138
Mark2 O08679 S43 Serine/threonine-protein kinase MARK2 NSATS*ADEQPHIGNYR 0.13 0.14
Nek7 D3ZBE5 S195 Serine/threonine-protein kinase Nek7 TTAAHS*LVGTPYYMSPER 0.13 0.142
Wdr91 B2RYI0 S256 WD repeat-containing protein 91 LGDSELALVC^SQRPASLSQS*PR 0.13 0.142
Zdhhc5 Q2THW7 S529;Y533 Palmitoyltransferase ZDHHC5 EPS*PVRY*DNLSR 0.13 0.145
Ag2 A8IHN8 S232 Uncharacterized protein C11orf96 homolog LRNS*LDSSDSDSAL 0.13 0.145
Leo1 Q641X2 S209;S217;S224;S232 RNA polymerase-associated protein LEO1 AQLS*DDDRQQLS*EEEKGNS*DDERPAAS*DNDEEK 0.13 0.148
Map4 Q5M7W5 T537 Microtubule-associated protein 4 NADLHSGT*ELTLDNSMTPPSDPALPLETK 0.13 0.15
Lrrfip2 Q4V7E8 S125;S128 Leucine-rich repeat flightless-interacting protein 2 NSASATTPLS*GNS*SR 0.13 0.151
Cttn Q66HL2 T364;S368;S380;S381 Src substrate cortactin QT*PPAS*PSPQPAEDRPPS*S*PIYEDAAPLK 0.13 0.153
Nup98 P49793 S934 Nuclear pore complex protein Nup98-Nup96 TAPLPPAGQATTFQMTLN#GKPAPPPQSQS*PEVEQLGR 0.13 0.153
Taok2 Q9JLS3 S9 Serine/threonine-protein kinase TAO2 AGS*LKDPDVAELFFK 0.13 0.154
Uba1 Q5U300 S13 Ubiquitin-like modifier-activating enzyme 1 RVS*GPDPKPGSN#C^SSAQ#SVLSEVSSVPTN#GMAK 0.13 0.154
Ppp1r1b Q6J4I0 S102 Protein phosphatase 1 regulatory subunit 1B IAESHLQTISNLSENQAS*EEEDELGELR 0.13 0.157
Ip6k1 Q9ESM0 S237 Inositol hexakisphosphate kinase 1 QHGDDAS*AEK 0.13 0.16
Anxa5 P14668 S44 Annexin A5 GLGTDEDSILN#LLTARS*N#AQ#R 0.13 0.163
Lsr Q9WU74 S375 Lipolysis-stimulated lipoprotein receptor AMS*EVT?SLHEDDWR 0.13 0.163
Aup1 A1L134 S290 Ancient ubiquitous protein 1 LRPQSVQSSFPSPPS*PSSDVQLTILAQR 0.13 0.164
Taf6 Q63801 S626;S634 Transcription initiation factor TFIID subunit 6 GGPPSHPS*PVPPSSSS*PSPLGGSALC^GGK 0.13 0.165
Adarb1 P51400 T73 Double-stranded RNA-specific editase 1 T*PGPVLPK 0.13 0.165
Epn1 O88339 S453 Epsin-1 SPGAFDM@SGVGGSLAESVGS*PPPAATPTPTPPTR 0.13 0.166
Esrra Q5QJV7 S19;S22;S27 Steroid hormone receptor ERR1 AEPAS*PDS*PKGSS*ETETEPPVTLASGPAPAR 0.13 0.166
Wdr44 Q9R037 S556;T571 WD repeat-containing protein 44 VS*PSPSQESLSSSKSDT*DMGVC^SGTDEDPDDK 0.13 0.169
Ag2 A8IHN8 S192 Uncharacterized protein C11orf96 homolog TQPVTFDEIQEVEEEGVS*PMEEEK 0.13 0.17
Camk2d P15791 S235 Calcium/calmodulin-dependent protein kinase type II subunit delta AGAYDFPS*PEWDTVTPEAK 0.13 0.17
Fosl2 P51145 S320 Fos-related antigen 2 RSSS?S?GDQSSDSLNS*PTLLAL 0.13 0.171
Rhbdf1 Q499S9 T183 Inactive rhomboid protein 1 MADDTADGLSAPHT?PVT*PGAASLC^SFSSSR 0.13 0.175
Sipa1l1 O35412 S288 Signal-induced proliferation-associated 1-like protein 1 S*ETGDSSIFR 0.13 0.178
Ssh3 Q5XIS1 S481 Protein phosphatase Slingshot homolog 3 VGVVS*PEEPLAPEVSTPLPPLPPEPGGSGEGM@VM@GQK 0.13 0.179
Srsf6 G3V6S8 S314;S316;S323 Serine/arginine-rich splicing factor 6 S*MS*PPPKRAS*R 0.13 0.186
Cdc27 Q4V8A2 S370 Cell division cycle protein 27 homolog EATPVLVAQTQ#SSGPQTSTT?PQVLSPTITS*PPNALPR 0.13 0.186
Tra2b P62997 S83;S85;S87 Transformer-2 protein homolog beta S*RS*YS*RDYR 0.13 0.187
Bckdha P11960 S333;S343 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (Fragment) IGHHS*TSDDSSAYRS*VDEVNYWDK 0.13 0.189
Map2 P15146 S1829;S1832;S1833;S1842 Microtubule-associated protein 2 RLS*NVS*S*SGSINLLES*PQ#LATLAEDVTAALAK 0.13 0.193
Srsf2 Q6PDU1 S206;S208;S212 Serine/arginine-rich splicing factor 2 S*KS*PPKS*PEEEGAVS?S 0.13 0.194
Bckdk Q00972 S31 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial S*TSATDTHHVELAR 0.13 0.195
Pik3r4 P0C0R5 T904 Phosphoinositide 3-kinase regulatory subunit 4 SESSAGVC^VPLST*SPQVSEAAHIPSK 0.13 0.198
Mapk1 P63086 T183 Mitogen-activated protein kinase 1 VADPDHDHTGFLT*EYVATR 0.13 0.198
Gys1 A2RRU1 S652;S657 Glycogen [starch] synthase, muscle HS*SPHQS*EDEEEPR 0.13 0.201
Slc9a1 P26431 S775;S776;S790 Sodium/hydrogen exchanger 1 SKEPS*S*PGTDDVFTPGPSDS*PGSQR 0.13 0.203
Ccnl2 Q5I0H5 S330;S337 Cyclin-L2 GLLPPGSAPGLDSATAGFS*PAPKPES*PK 0.13 0.208
Rere Q62901 S40 Arginine-glutamic acid dipeptide repeats protein RS*C^TLEGGAK 0.13 0.21
Tsc22d4 Q3B8N7 S254;S271 TSC22 domain family protein 4 VPPIDS*RPN#SPALYFDASLVHKS*PDPFGAAAAQSLSLAR 0.13 0.21
Smarcad1 D3Z9Z9 S210;S213 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 KLS*SSS*EAYEEDEANDDQSLK 0.13 0.214
Ncl P13383 S34;S40;S41 Nucleolin EVEEDSEDEEM@S*EDEDDS*S*GEEEVVIPQK 0.13 0.219
Plec P30427 S4621 Plectin GYYSPYSVS*GSGS?TAGSR 0.13 0.221
Nexn Q9Z2J4 S544;T551 Nexilin KREDDEEEEGS*IVN#GS?TT*EDEEQTR 0.13 0.227
Afap1l1 D4AB98 S148;S152 Actin filament-associated protein 1-like 1 SPEYISSHN#GC^S*PAQ#S*IVDGYYEDADSSYPTTR 0.13 0.229
Tpm1 P04692 S87 Tropomyosin alpha-1 chain ATDAEADVAS*LNR 0.13 0.231
Dek Q6AXS3 S245;S246;S253 Protein DEK DES*S*EDEEKES*EEEQPPKK 0.13 0.235
Dlgap4 P97839 T714 Disks large-associated protein 4 RDT*DSDTQDANDSSC^K 0.13 0.238
Rab11a P62494 S115 Ras-related protein Rab-11A DHADS*NIVIMLVGNK 0.13 0.242
Mapk14 P70618 T180 Mitogen-activated protein kinase 14 HTDDEM@T*GYVATR 0.13 0.247
Sh3kbp1 Q925Q9 S108 SH3 domain-containing kinase-binding protein 1 C^QVAFS*YLPQNDDELELK 0.13 0.248
Map2 P15146 S1821;S1824 Microtubule-associated protein 2 SS*VAS*PR 0.13 0.257
Git1 Q9Z272 Y392;S394;S397 ARF GTPase-activating protein GIT1 NQSDLDDQHDY*DS*VAS*DEDTDQEPLPSAGATR 0.13 0.257
Sarg Q499V8 S515 Specifically androgen-regulated gene protein DPGGQTSTS?LGKS*PFLDK 0.13 0.259
Epn3 Q4V882 S375 Epsin-3 LPSTGVDPWGAS*VETSNTSALGGASPFDPFAKPLESTEPM@ESR 0.13 0.26
Cir1 Q5U2T8 S404;S406;S408 Corepressor interacting with RBPJ 1 S*RS*RS*PC^GQK 0.13 0.264
Hp1bp3 Q6P747 S108 Heterochromatin protein 1-binding protein 3 GEPESGEKEES*KSAEETK 0.13 0.267
Canx P35565 T561;S563 Calnexin SDAEEDGGT*GS*QDEEDSKPK 0.13 0.269
Hmga1 Q8K585 S9 Zinc finger Ran-binding domain-containing protein 2 SS*QPLASK 0.13 0.275
Tmem246 Q5EB73 S180 Transmembrane protein 246 YEGTEDDYGDDPS*TNSFEK 0.13 0.279
Epb41l5 Q5FVG2 T613 Band 4.1-like protein 5 DSLT*PVHGTTADSDSVLK 0.13 0.282
Ring1 Q6MGB6 S232 E3 ubiquitin-protein ligase RING1 GGGAGGSSVGTGGGAAGGAC^GGAGSEDS*GDR 0.13 0.282
Inpp5j Q9JMC1 S905;S907;S909 Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A GGS*RS*PS*PQSR 0.13 0.29
Clip2 O55156 S203;S205;S208 CAP-Gly domain-containing linker protein 2 TGNES*GS*NLS*DSGSVK 0.13 0.296
Nucks1 Q9EPJ0 S73;S79 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 DDS*HSAEDS*EDEKDDHK 0.13 0.305
Gtf2f1 Q6AY96 T331 General transcription factor IIF subunit 1 APT*PQEK 0.13 0.309
Arfip1 Q9JHU5 S5 Arfaptin-1 A$EES*PK 0.13 0.312
Pcnp Q7TP40 S49 PEST proteolytic signal-containing nuclear protein TVSS*SN#GGESSSR 0.13 0.315
Thrap3 Q5M7V8 S238 Thyroid hormone receptor-associated protein 3 AS*VSDLSPR 0.13 0.318
Nucks1 Q9EPJ0 S54;S58;S61 Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 NS*QEDS*EDS*EEKDVK 0.13 0.319
Rsrc1 Q5PPJ2 S6 Serine/Arginine-related protein 53 RSS*DTEEESR 0.13 0.324
Cdc42bpb Q7TT49 S972 Serine/threonine-protein kinase MRCK beta TSSAS*DQETQASK 0.13 0.327
Sept8 B0BNF1 S313 Septin-8 LEEMGFQDS*DGDSQPFSLQETYEAK 0.12 6.81E-04
Trpv4 Q9ERZ8 S836 Transient receptor potential cation channel subfamily V member 4 VVELNKNS*GTDEVVVPLDNLGNPNC^DGHQQGYAPK 0.12 0.001
Pard3 Q9Z340 S809 Partitioning defective 3 homolog ATISDSADC^SLS*PDVDPVLAFQR 0.12 0.002
Prom2 Q8CJ52 T816;S817 Prominin-2 LSST*S*SEETQLFHIPR 0.12 0.003
Gal P10683 S124 Galanin peptides EAGALDSLPGIPLATSSEDLEQS* 0.12 0.003
Rtn1 Q64548 S350 Reticulon-1 GSVS*EDELIAAIK 0.12 0.004
Pds5b Q6TRW4 S1176;S1191 Sister chromatid cohesion protein PDS5 homolog B LDS*TEMDHSENEDYTMSS*PLPGK 0.12 0.005
Sept5 Q9JJM9 S225 Septin-5 FGIHVYQ#FPEC^DS*DEDEDFK 0.12 0.006
Cux1 P53565 S1043 Homeobox protein cut-like 1 TSASC^SPAPES*PMSSSESVK 0.12 0.011
Vcl P85972 S357 Vinculin AQQVS*QGLDVLTAK 0.12 0.012
Sqstm1 O08623 S364;S365 Sequestosome-1 EVDPSTGELQSLQMPESEGPS*S*LDPSQEGPTGLK 0.12 0.013
Prpf4b Q5RKH1 S576;S578;S580 Serine/threonine-protein kinase PRP4 homolog S*RS*PS*PDDILER 0.12 0.015
Akap8 Q63014 S326 A-kinase anchor protein 8 ADSEGDLS*EN#DDGAGDLR 0.12 0.015
Plec P30427 S4409 Plectin TQLAS*WSDPTEETGPVAGILDTETLEK 0.12 0.015
Farp1 F1LYQ8 S898;T902;S903 FERM, RhoGEF and pleckstrin domain-containing protein 1 SPDEATAADQESEDDLS*ASRT*S*LER 0.12 0.017
Arhgap29 Q5PQJ5 S516 Rho GTPase-activating protein 29 LEEDRC^S*NSADMTGPSFIR 0.12 0.018
S1pr5 Q9JKM5 S247 Sphingosine 1-phosphate receptor 5 S*LALLR 0.12 0.018
Zfyve26 D4A8G9 S1882 Zinc finger FYVE domain-containing protein 26 DAPEES*PC^QSEVPDSAK 0.12 0.019
Gorasp1 O35254 S379 Golgi reassembly-stacking protein 1 GGEATWSGSEFEISFPDSPGS*Q#AQVDHLPR 0.12 0.022
Epn2 Q9Z1Z3 S195;T200 Epsin-2 AGGSPAS*YHGST*SPR 0.12 0.022
Oxr1 Q4V8B0 S194;S195 Oxidation resistance protein 1 VVS*S*TSEEEEAFTEK 0.12 0.023
Ppp1r12a Q10728 S873 Protein phosphatase 1 regulatory subunit 12A STGVSFWTQDSDEN#EQERQS*DTEDGSSK 0.12 0.024
Prdm2 Q63755 S1253 PR domain zinc finger protein 2 EEELNDS*SEELYTTIK 0.12 0.024
Nup153 P49791 S210 Nuclear pore complex protein Nup153 NTSLPPLWS*PEAER 0.12 0.025
Trip13 Q5XHZ9 T197 Pachytene checkpoint protein 2 homolog T?SLC^KALAQ#KLT*IR 0.12 0.025
Pitpnm1 Q5U2N3 T270 Membrane-associated phosphatidylinositol transfer protein 1 C^NTGSEGPEAQT*PGKPSTETQPGTR 0.12 0.025
Golga4 Q5U4E6 T39;S41 Golgin subfamily A member 4 SRT*S?S*FTDQLDDATPNR 0.12 0.026
Cask Q62915 T460;T464 Peripheral plasma membrane protein CASK VT*PPPT*SPYLN#GDSPESAN#GDMDMENVTR 0.12 0.026
Arntl Q9EPW1 S534 Aryl hydrocarbon receptor nuclear translocator-like protein 1 GSSPSSC^GSSPLNITSTPPPDASS*PGGK 0.12 0.027
Specc1l Q2KN99 S385;S386 Cytospin-A KGS*S*GNASEVSVAC^LTER 0.12 0.029
Smarce1 Q56A18 T328 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 DEENIPMETEETHLEDTAENQ#QN#GEEGTST*PEDK 0.12 0.03
Prkab1 P80386 S180 5'-AMP-activated protein kinase subunit beta-1 C^SDVSELS*SSPPGPYHQEPYISKPEER 0.12 0.03
Mfap3l Q6AYP2 S298;S303;S306;S307 Microfibrillar-associated protein 3-like SES*PTADS*DAS*S*LHEQPQQIAIK 0.12 0.03
Rai14 Q5U312 S281 Ankycorbin APPPPIS*PTQLSDVSS?PR 0.12 0.032
Ssrp1 Q04931 S667;S668;S673 FACT complex subunit SSRP1 SKEFVS*S*DES?SS*GENK 0.12 0.033
Bad O35147 S113 Bcl2-associated agonist of cell death HSS*YPAGTEEDEGMEEELSPFR 0.12 0.034
Sptan1 P16086 S605 Spectrin alpha chain, non-erythrocytic 1 TATDEAYKDPS*NLQGK 0.12 0.036
Cdk12 Q3MJK5 T454 Cyclin-dependent kinase 12 ST*PDTELVNVAHSNTEVK 0.12 0.038
Camk2g P11730 S379 Calcium/calmodulin-dependent protein kinase type II subunit gamma GS*TESC^NTTTEDEDLK 0.12 0.038
Lgals5 P47967 Y26 Galectin-5 M@SSFSTQTPYPN#LAVPFFTSIPN#GLY*PSK 0.12 0.038
Camk2d P15791 S368 Calcium/calmodulin-dependent protein kinase type II subunit delta ESTESS*NTTIEDEDVK 0.12 0.04
L3mbtl2 Q3MIF2 S681;S687 Lethal(3)malignant brain tumor-like protein 2 EEHQDLPS*PDRSPS*PLLPLPTESIK 0.12 0.04
Kcnj16 P52191 S374 Inward rectifier potassium channel 16 S*FSAVAMVSSC^EN#PEETSLSPQDEC^K 0.12 0.04
Ppp1r37 B2RYF1 S564;S568 Protein phosphatase 1 regulatory subunit 37 DEGGTDQSSSAPC^PALLPSTDSLGPGDKS*PPGS*PSSPTEQ#R 0.12 0.041
Magi3 Q9JK71 S237 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 MDSS*LPEEEEDEDKEAVN#GSGSMETR 0.12 0.042
Fam122a Q6AYT4 S266;S269;S275 Protein FAM122A VSTTTDS*PVS*PAQAAS*PFIPVDELSSK 0.12 0.042
Trim2 D3ZQG6 T371;S375 Tripartite motif-containing protein 2 TGNAYLTAELST*PDGS*VADGEILDNK 0.12 0.042
Mark3 Q8VHF0 S378 MAP/microtubule affinity-regulating kinase 3 SAELDASDSSS*SSNLSLAK 0.12 0.043
Pacs1 O88588 S28 Phosphofurin acidic cluster sorting protein 1 GSGVAQS*PQQQPPQQPSQPQQPTPPK 0.12 0.044
Eif4e P63074 S24 Eukaryotic translation initiation factor 4E TES*NQEVANPEHYIK 0.12 0.044
Slc2a13 Q921A2 S44;S47 Proton myo-inositol cotransporter SLLAAES*AAS*LQGAELER 0.12 0.046
Rrad P55043 T51 GTP-binding protein RAD DLQAALT*PGSLAATAAGTR 0.12 0.046
Ssrp1 Q04931 S667;S668;S671;S672 FACT complex subunit SSRP1 EFVS*S*DES*S*SGENK 0.12 0.047
Mapk3 P21708 Y205 Mitogen-activated protein kinase 3 IADPEHDHTGFLTEY*VATR 0.12 0.047
Zdhhc5 Q2THW7 S529 Palmitoyltransferase ZDHHC5 LLPTGPPHREPS*PVR 0.12 0.048
Map2k1 Q01986 T23 Dual specificity mitogen-activated protein kinase kinase 1 KKPTPIQLNPAPDGSAVNGT*SSAETNLEALQK 0.12 0.051
Pxn Q66H76 S126;S130;S137 Paxillin S*AEPS*PTVM@SSS*LGSNLSELDR 0.12 0.052
Dvl1 Q9WVB9 S679 Segment polarity protein dishevelled homolog DVL-1 ELAAVPPELTGS?RQS*FQK 0.12 0.054
Akap13 F1M3G7 S1501 A-kinase anchor protein 13 EGESEPAGSGEMEEEEMDS*ITEVPANR 0.12 0.054
Tpr F1MA98 T653 Nucleoprotein TPR SSTSQTVST*PAPEPIIESTETIEAK 0.12 0.055
Pfkp P47860 S7 ATP-dependent 6-phosphofructokinase, platelet type S$DQDSS*TSSTSFPK 0.12 0.055
Arhgap17 Q99N37 T746;T748;S751;T752 Rho GTPase-activating protein 17 LGEQGPEPGPTPPQT*PT*PPS*T*PPPAK 0.12 0.056
Kif18b Q4KLL9 S156;Y157;Y161;Y166 Kinesin-like protein KIF18B LEAC^QEEKQFEVLIS*Y*LEVY*NEQIY*DLLEPK 0.12 0.059
Kif1b O88658 S527 Kinesin-like protein KIF1B EDGGTLGVFS*PK 0.12 0.059
Zhx3 Q80Z36 S922 Zinc fingers and homeoboxes protein 3 VLGDAC^AALSEN#S*EAWEPSAPEAGSEPFDTSSPQSGR 0.12 0.06
Add3 Q62847 S583;S585;S600 Gamma-adducin QQQGLDDAEQES*LS*DDAASVSQ#IQSQTQS*PQSVPER 0.12 0.061
Pde4a P54748 S140 cAMP-specific 3',5'-cyclic phosphodiesterase 4A RES*FLYR 0.12 0.063
Aldh1a3 Q8K4D8 S434 Aldehyde dehydrogenase family 1 member A3 ANS*TDYGLTAAVFTK 0.12 0.067
Mmtag2 Q5M9I6 S216;S217 Multiple myeloma tumor-associated protein 2 homolog EADSC^SS*S*PSPARPR 0.12 0.069
Cdc42bpa O54874 S750 Serine/threonine-protein kinase MRCK alpha RES*QSEREEFENEFK 0.12 0.072
Apc P70478 S2674 Adenomatous polyposis coli protein S*PTGNTPPVIDSISEK 0.12 0.073
Sh3kbp1 Q925Q9 S516 SH3 domain-containing kinase-binding protein 1 SNDIDLEGFDSVISS*TEK 0.12 0.074
Ndrg3 Q6AYR2 S334;S335 Protein NDRG3 THS?TSS*S*IGSGESPFSR 0.12 0.075
Slc9a3r1 Q9JJ19 S287;S288 Na(+)/H(+) exchange regulatory cofactor NHE-RF1 SAS*S*DTSEELNAQDSPK 0.12 0.077
Crlf2 Q8R4S8 S278 Cytokine receptor-like factor 2 GS*FPGLFEK 0.12 0.078
Lig1 Q9JHY8 S913 DNA ligase 1 QSQIQNQQSSDLDS*DVEDY 0.12 0.079
Cpt1a P32198 T689 Carnitine O-palmitoyltransferase 1, liver isoform LSTSQT*PQQQVELFDFEK 0.12 0.079
Ogfrl1 Q4KLH3 S65 Opioid growth factor receptor-like protein 1 AS*PVPEDHAEAAGAEQGGDSTEGNAKPK 0.12 0.079
Gpx1 P04041 T143 Glutathione peroxidase 1 NALPAPSDDPTALMT*DPK 0.12 0.08
Ahcyl1 B5DFN2 S27 S-adenosylhomocysteine hydrolase-like protein 1 SISQ#SSTDS*YSSAASYTDS?SDDEVSPR 0.12 0.08
Adnp Q9JKL8 S1072 Activity-dependent neuroprotector homeobox protein LPNPQIEWQNSTIDS*EDGEQ#FDSM@TDGVADPMHGSLTGVK 0.12 0.083
Wdr55 A1L112 S8;S13 WD repeat-containing protein 55 M$DPTC^Q#ES*PAEDS*N#NEEDLDSTK 0.12 0.087
Optn Q8R5M4 S217 Optineurin TDS*ISMGK 0.12 0.088
Pom121 P52591 S450 Nuclear envelope pore membrane protein POM 121 EEEPC^HQSSSSAPLVTDKES*PGEK 0.12 0.088
Prkce P09216 S346;T349 Protein kinase C epsilon type S*APT*SPC^DQELK 0.12 0.09
Vps50 F1LSG8 S546 Syndetin DEETEDVLASN#GYES*DEQEK 0.12 0.09
Ppp1r37 B2RYF1 S54 Protein phosphatase 1 regulatory subunit 37 VTFPS*DEDIVSGAVEPK 0.12 0.091
Cast P27321 S260;S281 Calpastatin N#EAITGPLPDS*PKPM@GIDHAIDALSSDFTC^SS*PTGK 0.12 0.091
Mtor P42346 S2448 Serine/threonine-protein kinase mTOR TDS*YSAGQ#SVEILDGVELGEPAHK 0.12 0.093
Map2 P15146 T1601 Microtubule-associated protein 2 SGTS?TPTT*PGSTAITPGTPPSYSSR 0.12 0.093
Zhx1 Q8R515 S648 Zinc fingers and homeoboxes protein 1 EEPGENS*PGDEAVAPK 0.12 0.096
Rabep1 O35550 S407 Rab GTPase-binding effector protein 1 AQS*TDSLGTSSSLQSK 0.12 0.096
Sh3kbp1 Q925Q9 S537 SH3 domain-containing kinase-binding protein 1 RPPS*Q#SLTSSSLSSPDIFDSPSPEEDKEEHISLAHR 0.12 0.097
Adgrl2 O88923 S1423;S1428 Adhesion G protein-coupled receptor L2 DSPYPESSPDMAEDLS*PSRRS*ENEDIYYK 0.12 0.098
Pxn Q66H76 S96 Paxillin N#SS*ASNPQDSVGSLC^SR 0.12 0.101
Tanc1 Q6F6B3 T208;S210 Protein TANC1 TAANKSPC^ET*IS*SPSSTLESK 0.12 0.101
Rab11fip1 Q3B7T9 S202;S205 Rab11 family-interacting protein 1 NKDNTSDTASAIVPSTTPS*VDS*DDESFSK 0.12 0.101
Arhgap17 Q99N37 T746;T748 Rho GTPase-activating protein 17 LGEQGPEPGPTPPQT*PT*PPSTPPPAK 0.12 0.101
Psip1 Q812D1 S102;S105;S106 PC4 and SFRS1-interacting protein FSSQQVSTKQS*NAS*S*DVEAEEK 0.12 0.102
Cttn Q66HL2 S370;S381;Y384 Src substrate cortactin KQTPPASPS*PQPAEDRPPSS*PIY*EDAAPLK 0.12 0.102
Pds5b Q6TRW4 S1176;S1182;T1188 Sister chromatid cohesion protein PDS5 homolog B GRLDS*TEMDHS*ENEDYT*MSSPLPGK 0.12 0.103
Add1 Q63028 S355 Alpha-adducin S*PGTPAGEGSGSPPK 0.12 0.103
Sipa1l2 Q5JCS6 S380;S384 Signal-induced proliferation-associated 1-like protein 2 NITTGASAASQTPVPVGPAGGC^ES*PLGS*KEDLNAK 0.12 0.104
Pard3 Q9Z340 S144 Partitioning defective 3 homolog SS*DPALTGLSTSVSDNNFSSEEPSR 0.12 0.104
Mark3 Q8VHF0 S439 MAP/microtubule affinity-regulating kinase 3 SQTS*TADSDLKEDGVPSR 0.12 0.109
Sirt1 A0A0G2JZ79 S346 NAD-dependent protein deacetylase sirtuin-1 ELVHLSELPPTPLHISEDS*S?SPER 0.12 0.11
Sptbn2 Q9QWN8 S2200 Spectrin beta chain, non-erythrocytic 2 SS*ESAHVATLPAR 0.12 0.11
Map2 P15146 S1820;S1821;S1824 Microtubule-associated protein 2 VDHGAEIITQSPSRS*S*VAS*PR 0.12 0.111
Dbnl Q9JHL4 S24 Drebrin-like protein VVTEKS*PTDWALFTYEGNSNDIR 0.12 0.12
Casc3 Q8K3X0 S10 Protein CASC3 QRAS*QDTEDEESGASGSDSGSPAR 0.12 0.12
Alkbh5 D3ZKD3 S253 RNA demethylase ALKBH5 RGS*VTVLSGYAADEITHC^IRPQDIK 0.12 0.12
Cdc42ep1 A1A5P0 S347;S350 Cdc42 effector protein 1 ELAGVLPQVHGS*WES*LNEEWSAPPASSR 0.12 0.121
Tmx2 Q5XIK2 S274 Thioredoxin-related transmembrane protein 2 GGDMS*EEKPGNPTPTAVPDGENK 0.12 0.122
Tm9sf1 Q66HF2 S275;S276 Transmembrane 9 superfamily member 1 YNLDEETS*S*GGSSDDFDQ#GDN#GWK 0.12 0.122
Farp1 F1LYQ8 S893;S900;S903 FERM, RhoGEF and pleckstrin domain-containing protein 1 SPDEATAADQES*EDDLSAS*RTS*LER 0.12 0.124
Phactr2 P62025 S398 Phosphatase and actin regulator 2 EYQANDSDSDGPILYTDDDDEEDDDDDS*TGESALASK 0.12 0.124
Sccpdh Q6AY30 S217 Saccharopine dehydrogenase-like oxidoreductase SVS*NLKPVPVIGSK 0.12 0.125
Marcksl1 Q9EPH2